Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397U0B0

Protein Details
Accession A0A397U0B0    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
79-111IEKVYKRKNNSKLSEKTNKRRKYSKINFNNLIEHydrophilic
NLS Segment(s)
PositionSequence
86-100KNNSKLSEKTNKRRK
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
Amino Acid Sequences PEEDASEENVAYAIAVAQTILNPNYDKLTIEENVIKKLAARHLVRLKNGDPLSNPCSEIDSCDEESDKFKEPISNKVEIEKVYKRKNNSKLSEKTNKRRKYSKINFNNLIELIRNISN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.08
7 0.08
8 0.1
9 0.1
10 0.11
11 0.14
12 0.14
13 0.14
14 0.13
15 0.17
16 0.16
17 0.18
18 0.22
19 0.21
20 0.23
21 0.22
22 0.2
23 0.18
24 0.2
25 0.22
26 0.25
27 0.24
28 0.3
29 0.39
30 0.43
31 0.43
32 0.44
33 0.4
34 0.4
35 0.4
36 0.33
37 0.26
38 0.28
39 0.29
40 0.26
41 0.25
42 0.17
43 0.19
44 0.18
45 0.18
46 0.15
47 0.15
48 0.15
49 0.15
50 0.15
51 0.13
52 0.16
53 0.16
54 0.17
55 0.14
56 0.14
57 0.19
58 0.2
59 0.28
60 0.3
61 0.32
62 0.29
63 0.32
64 0.33
65 0.29
66 0.34
67 0.33
68 0.37
69 0.42
70 0.47
71 0.51
72 0.59
73 0.67
74 0.71
75 0.72
76 0.74
77 0.72
78 0.77
79 0.81
80 0.81
81 0.82
82 0.83
83 0.83
84 0.81
85 0.82
86 0.82
87 0.82
88 0.83
89 0.83
90 0.83
91 0.85
92 0.84
93 0.78
94 0.74
95 0.63
96 0.54
97 0.44
98 0.35