Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VUI7

Protein Details
Accession A0A397VUI7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-40KRSNKENEFKLQNKKKKQRVLDESGNSHydrophilic
NLS Segment(s)
PositionSequence
26-30NKKKK
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSALSRIDNQGRAKRSNKENEFKLQNKKKKQRVLDESGNSREEKKADSSSNNKENKADPPNGYGEGSKPYEANGNDEELKPCEKNKADPLSNHKENKADPSDGYDEGSKSHKASGNDEESKPRDESDRSFYFFIEKGYYSNFHFKSCDKSTICNLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.68
4 0.71
5 0.72
6 0.71
7 0.73
8 0.76
9 0.74
10 0.76
11 0.76
12 0.76
13 0.78
14 0.84
15 0.84
16 0.84
17 0.86
18 0.86
19 0.85
20 0.84
21 0.82
22 0.79
23 0.75
24 0.7
25 0.63
26 0.53
27 0.45
28 0.38
29 0.3
30 0.25
31 0.23
32 0.24
33 0.26
34 0.32
35 0.38
36 0.44
37 0.52
38 0.53
39 0.49
40 0.46
41 0.45
42 0.46
43 0.44
44 0.4
45 0.33
46 0.32
47 0.33
48 0.32
49 0.31
50 0.23
51 0.18
52 0.18
53 0.18
54 0.15
55 0.13
56 0.12
57 0.16
58 0.16
59 0.18
60 0.15
61 0.16
62 0.17
63 0.17
64 0.18
65 0.14
66 0.16
67 0.13
68 0.13
69 0.17
70 0.17
71 0.2
72 0.26
73 0.33
74 0.34
75 0.37
76 0.45
77 0.49
78 0.54
79 0.53
80 0.47
81 0.42
82 0.4
83 0.43
84 0.38
85 0.3
86 0.24
87 0.26
88 0.28
89 0.25
90 0.26
91 0.2
92 0.17
93 0.17
94 0.19
95 0.16
96 0.13
97 0.18
98 0.2
99 0.21
100 0.25
101 0.31
102 0.37
103 0.4
104 0.41
105 0.44
106 0.42
107 0.44
108 0.4
109 0.34
110 0.29
111 0.28
112 0.31
113 0.32
114 0.34
115 0.35
116 0.35
117 0.34
118 0.33
119 0.31
120 0.28
121 0.23
122 0.19
123 0.17
124 0.2
125 0.22
126 0.23
127 0.32
128 0.31
129 0.3
130 0.32
131 0.33
132 0.38
133 0.41
134 0.46
135 0.39
136 0.43