Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VXM5

Protein Details
Accession A0A397VXM5    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
91-118EVREQKAVPYKQRRKAQPKKHYASQSDVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 16.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MTRIEITEKHSSNNKHDAPGEQEVIRYRKLVARIFGLEKTVKKLERDVAFLETELDDLDDCVDKSTVVDLIHEIVPTLINEKEFDSVEIIEVREQKAVPYKQRRKAQPKKHYASQSDVSDLRIGQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.47
3 0.48
4 0.47
5 0.45
6 0.46
7 0.42
8 0.32
9 0.32
10 0.33
11 0.34
12 0.32
13 0.26
14 0.23
15 0.23
16 0.29
17 0.3
18 0.27
19 0.28
20 0.31
21 0.32
22 0.31
23 0.31
24 0.28
25 0.25
26 0.28
27 0.29
28 0.27
29 0.26
30 0.29
31 0.33
32 0.32
33 0.33
34 0.3
35 0.27
36 0.25
37 0.24
38 0.21
39 0.14
40 0.12
41 0.09
42 0.07
43 0.05
44 0.04
45 0.05
46 0.04
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.07
54 0.06
55 0.07
56 0.06
57 0.08
58 0.09
59 0.08
60 0.08
61 0.06
62 0.06
63 0.06
64 0.08
65 0.07
66 0.07
67 0.08
68 0.09
69 0.1
70 0.1
71 0.11
72 0.1
73 0.1
74 0.1
75 0.11
76 0.1
77 0.11
78 0.13
79 0.13
80 0.13
81 0.13
82 0.14
83 0.22
84 0.27
85 0.35
86 0.45
87 0.54
88 0.62
89 0.71
90 0.8
91 0.82
92 0.87
93 0.89
94 0.88
95 0.9
96 0.89
97 0.89
98 0.87
99 0.81
100 0.78
101 0.74
102 0.66
103 0.6
104 0.52
105 0.45
106 0.38