Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UC97

Protein Details
Accession A0A397UC97    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-46WDGKYHKTCIKYKQNRDLKKQNNTVSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14, cyto_nucl 13, nucl 10
Family & Domain DBs
Amino Acid Sequences MDSKKFCTNCKTFHFEFQFVWDGKYHKTCIKYKQNRDLKKQNNTVSVNSKLSQPTISVSSQLLNLEFNSEELNVKDEAEHMRIEIDYFDVGNFEGVANTDYQIHLLVNLDAATIQNMMAKDIANLVVAEIEGGDDYSWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.56
3 0.5
4 0.47
5 0.47
6 0.39
7 0.38
8 0.3
9 0.26
10 0.28
11 0.32
12 0.3
13 0.28
14 0.34
15 0.39
16 0.47
17 0.56
18 0.62
19 0.68
20 0.75
21 0.81
22 0.82
23 0.86
24 0.86
25 0.84
26 0.84
27 0.82
28 0.77
29 0.75
30 0.7
31 0.64
32 0.59
33 0.54
34 0.47
35 0.39
36 0.36
37 0.28
38 0.26
39 0.23
40 0.17
41 0.15
42 0.15
43 0.15
44 0.13
45 0.13
46 0.12
47 0.13
48 0.12
49 0.11
50 0.08
51 0.08
52 0.08
53 0.07
54 0.07
55 0.06
56 0.06
57 0.07
58 0.06
59 0.08
60 0.07
61 0.07
62 0.07
63 0.08
64 0.09
65 0.1
66 0.1
67 0.08
68 0.09
69 0.08
70 0.09
71 0.08
72 0.07
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.04
81 0.04
82 0.04
83 0.05
84 0.05
85 0.06
86 0.06
87 0.06
88 0.06
89 0.07
90 0.06
91 0.06
92 0.07
93 0.07
94 0.07
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.05
101 0.05
102 0.08
103 0.08
104 0.09
105 0.09
106 0.09
107 0.09
108 0.1
109 0.11
110 0.09
111 0.09
112 0.08
113 0.08
114 0.07
115 0.07
116 0.05
117 0.05
118 0.04
119 0.05