Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UCD2

Protein Details
Accession A0A397UCD2    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-32SNESKDSSLKSNKKRRLNEDEIHHydrophilic
76-96EQEKKKARLKFEREKWEHKKEBasic
NLS Segment(s)
PositionSequence
67-96EKEKERLKFEQEKKKARLKFEREKWEHKKE
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MTKSSLEQKSNESKDSSLKSNKKRRLNEDEIHYIKSMDTITQSKKIEPETRKKLYDLEKDKFEYEREKEKERLKFEQEKKKARLKFEREKWEHKKEMEKEKLNLDLEKYKLELDHKLQLELKTKELELKYKNNIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.47
4 0.47
5 0.52
6 0.59
7 0.67
8 0.75
9 0.77
10 0.82
11 0.83
12 0.82
13 0.82
14 0.78
15 0.75
16 0.76
17 0.68
18 0.61
19 0.52
20 0.42
21 0.33
22 0.28
23 0.21
24 0.12
25 0.13
26 0.16
27 0.19
28 0.25
29 0.26
30 0.26
31 0.28
32 0.32
33 0.37
34 0.4
35 0.47
36 0.49
37 0.54
38 0.54
39 0.53
40 0.53
41 0.53
42 0.56
43 0.53
44 0.48
45 0.46
46 0.46
47 0.46
48 0.42
49 0.35
50 0.31
51 0.27
52 0.33
53 0.32
54 0.35
55 0.39
56 0.45
57 0.5
58 0.48
59 0.5
60 0.48
61 0.55
62 0.59
63 0.64
64 0.66
65 0.69
66 0.7
67 0.73
68 0.7
69 0.68
70 0.7
71 0.69
72 0.71
73 0.71
74 0.76
75 0.74
76 0.8
77 0.8
78 0.79
79 0.76
80 0.69
81 0.69
82 0.66
83 0.71
84 0.7
85 0.67
86 0.61
87 0.59
88 0.61
89 0.53
90 0.47
91 0.4
92 0.36
93 0.32
94 0.3
95 0.28
96 0.22
97 0.22
98 0.24
99 0.26
100 0.24
101 0.31
102 0.31
103 0.34
104 0.37
105 0.39
106 0.45
107 0.41
108 0.4
109 0.35
110 0.34
111 0.38
112 0.37
113 0.41
114 0.39
115 0.45