Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397W6E4

Protein Details
Accession A0A397W6E4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
260-283SIETNTTNKRKKFKNKKVLIVLIAHydrophilic
NLS Segment(s)
PositionSequence
269-273RKKFK
Subcellular Location(s) nucl 14.5, cyto_nucl 12.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007220  ORC2  
Gene Ontology GO:0005664  C:nuclear origin of replication recognition complex  
GO:0003688  F:DNA replication origin binding  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF04084  ORC2  
Amino Acid Sequences MKTRTSNNTLAGVDILDKAECMSILTKIPVKHKTEIESLTELYKCQFLQWYIELMSGFNLLFYGYGSKKKLLEEFSEAYLRDRPLLVINGFLSKLKIKEVFLQVINGVDMGVKPGSRETLEELTELIREYFADSDRKVQNLYIMIHNIDGQGLRTLQIQNCLSILASSPNIYFIASTDHINSTLLFDQDRATNSSVIPYDGIYEEACDKLYSEPYDEFYDKPYGKPHDKPYNKLYNDNATQKPTNIISSDEFGDNELLISIETNTTNKRKKFKNKKVLIVLIAVCDHCGNGLKIHKDRLTLSFRNHLIHLYKNKVLELKESNKPNTELPQNTIDQGHESFDFKKFIDFIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.1
4 0.1
5 0.1
6 0.09
7 0.09
8 0.09
9 0.09
10 0.1
11 0.13
12 0.17
13 0.21
14 0.24
15 0.32
16 0.39
17 0.43
18 0.47
19 0.49
20 0.51
21 0.53
22 0.52
23 0.49
24 0.44
25 0.4
26 0.37
27 0.33
28 0.29
29 0.23
30 0.22
31 0.17
32 0.16
33 0.19
34 0.17
35 0.22
36 0.23
37 0.25
38 0.23
39 0.25
40 0.23
41 0.18
42 0.18
43 0.14
44 0.12
45 0.08
46 0.07
47 0.06
48 0.06
49 0.06
50 0.1
51 0.11
52 0.17
53 0.2
54 0.23
55 0.25
56 0.28
57 0.32
58 0.31
59 0.34
60 0.35
61 0.35
62 0.35
63 0.36
64 0.33
65 0.3
66 0.3
67 0.27
68 0.21
69 0.19
70 0.17
71 0.17
72 0.21
73 0.19
74 0.17
75 0.17
76 0.17
77 0.18
78 0.17
79 0.15
80 0.14
81 0.14
82 0.16
83 0.18
84 0.18
85 0.24
86 0.28
87 0.31
88 0.29
89 0.29
90 0.26
91 0.24
92 0.22
93 0.15
94 0.1
95 0.06
96 0.05
97 0.06
98 0.06
99 0.06
100 0.06
101 0.07
102 0.09
103 0.09
104 0.1
105 0.13
106 0.16
107 0.16
108 0.16
109 0.16
110 0.15
111 0.14
112 0.14
113 0.09
114 0.06
115 0.05
116 0.06
117 0.07
118 0.09
119 0.11
120 0.11
121 0.18
122 0.2
123 0.21
124 0.2
125 0.19
126 0.2
127 0.2
128 0.22
129 0.17
130 0.16
131 0.16
132 0.16
133 0.16
134 0.13
135 0.1
136 0.08
137 0.07
138 0.06
139 0.06
140 0.06
141 0.08
142 0.1
143 0.11
144 0.16
145 0.16
146 0.15
147 0.15
148 0.15
149 0.12
150 0.1
151 0.1
152 0.06
153 0.06
154 0.07
155 0.06
156 0.07
157 0.07
158 0.07
159 0.07
160 0.05
161 0.09
162 0.09
163 0.1
164 0.1
165 0.11
166 0.11
167 0.11
168 0.11
169 0.09
170 0.09
171 0.09
172 0.08
173 0.08
174 0.09
175 0.1
176 0.12
177 0.12
178 0.12
179 0.13
180 0.13
181 0.14
182 0.14
183 0.12
184 0.11
185 0.09
186 0.08
187 0.08
188 0.09
189 0.06
190 0.07
191 0.07
192 0.07
193 0.08
194 0.06
195 0.07
196 0.07
197 0.1
198 0.1
199 0.12
200 0.12
201 0.15
202 0.19
203 0.19
204 0.18
205 0.18
206 0.24
207 0.22
208 0.23
209 0.26
210 0.29
211 0.34
212 0.4
213 0.46
214 0.51
215 0.55
216 0.59
217 0.62
218 0.66
219 0.62
220 0.6
221 0.55
222 0.52
223 0.53
224 0.55
225 0.49
226 0.44
227 0.43
228 0.39
229 0.38
230 0.31
231 0.27
232 0.21
233 0.21
234 0.17
235 0.18
236 0.2
237 0.17
238 0.16
239 0.15
240 0.14
241 0.11
242 0.1
243 0.08
244 0.06
245 0.05
246 0.05
247 0.05
248 0.06
249 0.07
250 0.08
251 0.13
252 0.21
253 0.29
254 0.35
255 0.43
256 0.52
257 0.63
258 0.73
259 0.79
260 0.82
261 0.84
262 0.88
263 0.89
264 0.84
265 0.75
266 0.68
267 0.57
268 0.48
269 0.4
270 0.3
271 0.21
272 0.16
273 0.13
274 0.09
275 0.11
276 0.1
277 0.14
278 0.21
279 0.27
280 0.31
281 0.38
282 0.4
283 0.4
284 0.42
285 0.44
286 0.47
287 0.45
288 0.46
289 0.47
290 0.47
291 0.47
292 0.45
293 0.42
294 0.37
295 0.4
296 0.43
297 0.42
298 0.43
299 0.42
300 0.44
301 0.44
302 0.42
303 0.41
304 0.41
305 0.42
306 0.46
307 0.52
308 0.54
309 0.54
310 0.55
311 0.52
312 0.5
313 0.53
314 0.48
315 0.45
316 0.47
317 0.44
318 0.43
319 0.41
320 0.34
321 0.29
322 0.26
323 0.25
324 0.2
325 0.21
326 0.22
327 0.24
328 0.26
329 0.22
330 0.25