Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397W028

Protein Details
Accession A0A397W028    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
121-142VRYFADCWKTPKKDRKSKLKKKBasic
NLS Segment(s)
PositionSequence
131-142PKKDRKSKLKKK
Subcellular Location(s) nucl 12.5, mito_nucl 11.5, mito 9.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSVRALVNLYENTDSPLVRNQFKNWFTVALIGPCIGMCMRTAQLGTDIKRTDALSLASSNRKYHNWPNNLKKFMGQKIDSIQIIKNNLDVLNSKGNNDIEPDENALYNELLSIPLPFLCLVRYFADCWKTPKKDRKSKLKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.24
4 0.25
5 0.29
6 0.32
7 0.33
8 0.41
9 0.42
10 0.43
11 0.37
12 0.34
13 0.28
14 0.3
15 0.27
16 0.19
17 0.18
18 0.15
19 0.14
20 0.12
21 0.12
22 0.08
23 0.07
24 0.06
25 0.08
26 0.08
27 0.09
28 0.09
29 0.09
30 0.14
31 0.18
32 0.19
33 0.22
34 0.22
35 0.21
36 0.23
37 0.23
38 0.19
39 0.16
40 0.15
41 0.11
42 0.13
43 0.15
44 0.18
45 0.19
46 0.2
47 0.21
48 0.21
49 0.25
50 0.33
51 0.39
52 0.43
53 0.51
54 0.59
55 0.65
56 0.66
57 0.61
58 0.56
59 0.52
60 0.48
61 0.45
62 0.36
63 0.3
64 0.3
65 0.32
66 0.29
67 0.25
68 0.21
69 0.18
70 0.19
71 0.17
72 0.15
73 0.13
74 0.13
75 0.13
76 0.13
77 0.13
78 0.19
79 0.19
80 0.19
81 0.22
82 0.22
83 0.21
84 0.22
85 0.21
86 0.15
87 0.16
88 0.18
89 0.15
90 0.15
91 0.14
92 0.13
93 0.11
94 0.09
95 0.08
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.07
103 0.07
104 0.07
105 0.08
106 0.09
107 0.12
108 0.13
109 0.15
110 0.17
111 0.22
112 0.27
113 0.28
114 0.34
115 0.41
116 0.47
117 0.55
118 0.64
119 0.7
120 0.76
121 0.83
122 0.88