Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397V7A1

Protein Details
Accession A0A397V7A1    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
38-65VTTRGKDFRAQKTKKKRGSYRGGKIDLQHydrophilic
NLS Segment(s)
PositionSequence
46-56RAQKTKKKRGS
Subcellular Location(s) nucl 13, cyto_nucl 12, cyto 9, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences RINVNEVKFHNEKLKDNSFLAKDGAVGSYGHKAYNDFVTTRGKDFRAQKTKKKRGSYRGGKIDLQSHSIKFED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.46
4 0.48
5 0.41
6 0.38
7 0.33
8 0.25
9 0.19
10 0.16
11 0.15
12 0.1
13 0.09
14 0.08
15 0.11
16 0.12
17 0.11
18 0.11
19 0.11
20 0.12
21 0.14
22 0.14
23 0.1
24 0.12
25 0.17
26 0.18
27 0.19
28 0.21
29 0.19
30 0.24
31 0.31
32 0.39
33 0.45
34 0.51
35 0.59
36 0.68
37 0.77
38 0.8
39 0.84
40 0.83
41 0.82
42 0.87
43 0.87
44 0.86
45 0.86
46 0.82
47 0.74
48 0.68
49 0.64
50 0.55
51 0.49
52 0.43
53 0.34