Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LYA3

Protein Details
Accession E2LYA3   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
69-92ERCRGKQNKGPKRSGRGGRRKTGGBasic
NLS Segment(s)
PositionSequence
73-99GKQNKGPKRSGRGGRRKTGGNRGGRGT
Subcellular Location(s) cyto_nucl 10.833, nucl 10, cyto 9.5, cyto_pero 6.666, mito 3, pero 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
KEGG mpr:MPER_12284  -  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
PS50016  ZF_PHD_2  
Amino Acid Sequences MNGMTAADTSTEVGDGDADGDNDDRTYCLCNRVSFGEMIGCDNADCEIEWYHLSCVGLEVVPDGNWVCERCRGKQNKGPKRSGRGGRRKTGGNRGGRGTAGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.06
6 0.07
7 0.07
8 0.07
9 0.08
10 0.08
11 0.07
12 0.07
13 0.1
14 0.11
15 0.16
16 0.18
17 0.19
18 0.21
19 0.23
20 0.24
21 0.21
22 0.2
23 0.17
24 0.14
25 0.14
26 0.12
27 0.1
28 0.08
29 0.08
30 0.07
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.07
37 0.07
38 0.07
39 0.08
40 0.08
41 0.07
42 0.07
43 0.06
44 0.06
45 0.05
46 0.06
47 0.05
48 0.05
49 0.06
50 0.05
51 0.05
52 0.07
53 0.08
54 0.08
55 0.16
56 0.18
57 0.23
58 0.33
59 0.4
60 0.47
61 0.53
62 0.63
63 0.66
64 0.73
65 0.78
66 0.77
67 0.78
68 0.79
69 0.82
70 0.82
71 0.83
72 0.82
73 0.81
74 0.78
75 0.78
76 0.76
77 0.77
78 0.74
79 0.71
80 0.68
81 0.63
82 0.61