Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UAE1

Protein Details
Accession A0A397UAE1    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
104-131VREQKVVPYKQRRKARPKSKNCEKAGSQHydrophilic
NLS Segment(s)
PositionSequence
114-122QRRKARPKS
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MTRIEITEKHSSNNKRDAPGEQEVIRCRKLVARIFGLEKTVKKLERDVGFLETELEDLGDSVDKGTVVDLIHEIVPTLINEKSKSSPDLSDSSEESDSVEIIEVREQKVVPYKQRRKARPKSKNCEKAGSQLRDIFLAKCSDETLRKKMERSEKVYKLFNSIGKEKISRIKSIPPGFILNLTKDEKDYVMAEILKRKVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.55
3 0.57
4 0.56
5 0.54
6 0.53
7 0.5
8 0.43
9 0.43
10 0.45
11 0.47
12 0.44
13 0.37
14 0.32
15 0.32
16 0.37
17 0.39
18 0.39
19 0.39
20 0.41
21 0.44
22 0.44
23 0.43
24 0.39
25 0.33
26 0.32
27 0.33
28 0.32
29 0.31
30 0.34
31 0.38
32 0.37
33 0.39
34 0.35
35 0.32
36 0.3
37 0.28
38 0.25
39 0.17
40 0.14
41 0.11
42 0.08
43 0.05
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.05
62 0.06
63 0.05
64 0.07
65 0.07
66 0.09
67 0.1
68 0.12
69 0.14
70 0.15
71 0.17
72 0.17
73 0.17
74 0.19
75 0.21
76 0.2
77 0.2
78 0.19
79 0.19
80 0.17
81 0.16
82 0.13
83 0.11
84 0.09
85 0.07
86 0.06
87 0.04
88 0.04
89 0.07
90 0.08
91 0.08
92 0.09
93 0.09
94 0.1
95 0.18
96 0.21
97 0.28
98 0.38
99 0.46
100 0.54
101 0.64
102 0.73
103 0.76
104 0.83
105 0.86
106 0.85
107 0.87
108 0.89
109 0.91
110 0.92
111 0.84
112 0.8
113 0.71
114 0.69
115 0.68
116 0.61
117 0.53
118 0.46
119 0.42
120 0.37
121 0.37
122 0.28
123 0.2
124 0.18
125 0.15
126 0.13
127 0.14
128 0.15
129 0.22
130 0.26
131 0.3
132 0.36
133 0.39
134 0.41
135 0.47
136 0.55
137 0.55
138 0.59
139 0.63
140 0.62
141 0.65
142 0.68
143 0.61
144 0.57
145 0.52
146 0.48
147 0.44
148 0.4
149 0.39
150 0.37
151 0.37
152 0.35
153 0.39
154 0.38
155 0.37
156 0.37
157 0.42
158 0.48
159 0.51
160 0.51
161 0.45
162 0.45
163 0.42
164 0.44
165 0.38
166 0.31
167 0.32
168 0.32
169 0.29
170 0.27
171 0.28
172 0.23
173 0.22
174 0.21
175 0.17
176 0.19
177 0.21
178 0.23
179 0.28