Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TYI4

Protein Details
Accession A0A397TYI4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
7-27QNTYPWSQRKLRHNPFPRFEHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011043  Gal_Oxase/kelch_b-propeller  
IPR015915  Kelch-typ_b-propeller  
Pfam View protein in Pfam  
PF13418  Kelch_4  
Amino Acid Sequences MAQRRPQNTYPWSQRKLRHNPFPRFEHSANDASINNEIFIFGGIYQGQATNDVYVIETSNYLKNSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.78
4 0.77
5 0.77
6 0.78
7 0.81
8 0.81
9 0.79
10 0.74
11 0.7
12 0.62
13 0.55
14 0.49
15 0.42
16 0.35
17 0.31
18 0.26
19 0.19
20 0.2
21 0.15
22 0.11
23 0.08
24 0.08
25 0.06
26 0.06
27 0.05
28 0.04
29 0.05
30 0.05
31 0.05
32 0.05
33 0.06
34 0.06
35 0.08
36 0.08
37 0.08
38 0.08
39 0.08
40 0.08
41 0.08
42 0.09
43 0.08
44 0.09
45 0.11
46 0.15