Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TST7

Protein Details
Accession A0A397TST7    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-43AFTTPSQYTKQRCPRCRRKGHSILECPNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 12.833, mito_nucl 11.499, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MKKEQKQKLLYELYSAFTTPSQYTKQRCPRCRRKGHSILECPNMKLLDEKCVMLVRALTPEQSEELQEIIDKKFSGPLSDEQIPSALDFILQVLEHIITKDEDYHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.24
4 0.17
5 0.19
6 0.15
7 0.17
8 0.2
9 0.26
10 0.31
11 0.4
12 0.5
13 0.58
14 0.67
15 0.74
16 0.8
17 0.84
18 0.9
19 0.88
20 0.88
21 0.88
22 0.88
23 0.87
24 0.84
25 0.78
26 0.75
27 0.68
28 0.57
29 0.49
30 0.4
31 0.3
32 0.25
33 0.2
34 0.18
35 0.18
36 0.18
37 0.16
38 0.17
39 0.17
40 0.13
41 0.12
42 0.07
43 0.09
44 0.09
45 0.09
46 0.08
47 0.09
48 0.1
49 0.09
50 0.09
51 0.07
52 0.07
53 0.07
54 0.08
55 0.09
56 0.08
57 0.1
58 0.09
59 0.09
60 0.13
61 0.14
62 0.14
63 0.16
64 0.18
65 0.24
66 0.27
67 0.27
68 0.23
69 0.24
70 0.23
71 0.2
72 0.17
73 0.1
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.07
82 0.08
83 0.08
84 0.09
85 0.09
86 0.1