Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397WAZ7

Protein Details
Accession A0A397WAZ7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
53-74VCEACKKAFKRPQDLKKHKKTHBasic
NLS Segment(s)
PositionSequence
62-73KRPQDLKKHKKT
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences ETLYKHLSVEHVGRKSTGNLCLECHWDDCDIKTTKRDHITSHIRVHVPLKPHVCEACKKAFKRPQDLKKHKKTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.34
4 0.33
5 0.29
6 0.27
7 0.28
8 0.29
9 0.31
10 0.28
11 0.25
12 0.21
13 0.19
14 0.18
15 0.17
16 0.22
17 0.21
18 0.21
19 0.25
20 0.26
21 0.29
22 0.35
23 0.35
24 0.3
25 0.35
26 0.42
27 0.44
28 0.46
29 0.44
30 0.39
31 0.39
32 0.4
33 0.34
34 0.3
35 0.3
36 0.3
37 0.27
38 0.3
39 0.32
40 0.33
41 0.35
42 0.36
43 0.4
44 0.45
45 0.45
46 0.52
47 0.57
48 0.62
49 0.67
50 0.73
51 0.73
52 0.77
53 0.86
54 0.87