Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VVJ3

Protein Details
Accession A0A397VVJ3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
58-78HMQKYSEYKYQPRRPHEKKRRBasic
NLS Segment(s)
PositionSequence
70-78RRPHEKKRR
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences PPNAFILYRQAKQPAIVAASMIISNNEVSKKVGNMWHKESLEVKIKFQLLADIAKLEHMQKYSEYKYQPRRPHEKKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.23
3 0.21
4 0.18
5 0.14
6 0.14
7 0.13
8 0.1
9 0.07
10 0.06
11 0.06
12 0.08
13 0.08
14 0.08
15 0.09
16 0.1
17 0.11
18 0.13
19 0.19
20 0.23
21 0.27
22 0.31
23 0.36
24 0.35
25 0.36
26 0.34
27 0.33
28 0.36
29 0.32
30 0.28
31 0.25
32 0.26
33 0.25
34 0.23
35 0.21
36 0.13
37 0.14
38 0.13
39 0.1
40 0.1
41 0.1
42 0.11
43 0.1
44 0.12
45 0.11
46 0.12
47 0.14
48 0.21
49 0.24
50 0.29
51 0.34
52 0.41
53 0.51
54 0.6
55 0.66
56 0.7
57 0.77
58 0.81