Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VJ15

Protein Details
Accession A0A397VJ15    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGNKQSTKLTKNKNKSKISLKSTTNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito_nucl 11.833, mito 10.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR041698  Methyltransf_25  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF13649  Methyltransf_25  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MGNKQSTKLTKNKNKSKISLKSTTNEPKSWYVEGRRYANYKNSKYFFPEDDIEIDRLQMQHYLFRNIFYGNFSAPVEDMLKQGGRILDIGCGPGTWVLENSCNFVRSEFYGIDIAPMFPSMIKPRNAHFIQANILDGLPFEDNYFDFVHLGFLSACFSEENWITQVIPECIRVCKPNGWIEFYENDGAAFNGGPCYNRIVESLKQEFFTMDLNIRAAILYKDWLLKEPNLINVQEEVRKQSIGNRDCLAMIMEESLKILFQTLAPRLAKNLGISVNEFEEMLQDVHEEYNKYGTYMNFYRVYAQKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.87
4 0.85
5 0.83
6 0.81
7 0.75
8 0.7
9 0.71
10 0.73
11 0.69
12 0.61
13 0.57
14 0.54
15 0.54
16 0.53
17 0.5
18 0.47
19 0.49
20 0.54
21 0.54
22 0.54
23 0.54
24 0.55
25 0.57
26 0.6
27 0.59
28 0.61
29 0.59
30 0.56
31 0.58
32 0.58
33 0.51
34 0.46
35 0.42
36 0.35
37 0.35
38 0.35
39 0.31
40 0.26
41 0.23
42 0.19
43 0.17
44 0.16
45 0.16
46 0.13
47 0.18
48 0.2
49 0.26
50 0.25
51 0.26
52 0.26
53 0.24
54 0.24
55 0.2
56 0.19
57 0.13
58 0.15
59 0.14
60 0.13
61 0.12
62 0.13
63 0.12
64 0.11
65 0.11
66 0.11
67 0.12
68 0.11
69 0.13
70 0.12
71 0.1
72 0.11
73 0.11
74 0.1
75 0.1
76 0.11
77 0.09
78 0.08
79 0.08
80 0.08
81 0.08
82 0.06
83 0.07
84 0.07
85 0.11
86 0.12
87 0.15
88 0.15
89 0.16
90 0.15
91 0.15
92 0.16
93 0.13
94 0.16
95 0.13
96 0.14
97 0.14
98 0.13
99 0.14
100 0.12
101 0.11
102 0.08
103 0.08
104 0.06
105 0.05
106 0.07
107 0.11
108 0.16
109 0.2
110 0.21
111 0.23
112 0.31
113 0.32
114 0.32
115 0.29
116 0.25
117 0.24
118 0.23
119 0.22
120 0.13
121 0.13
122 0.1
123 0.09
124 0.08
125 0.06
126 0.05
127 0.05
128 0.05
129 0.05
130 0.08
131 0.08
132 0.07
133 0.07
134 0.07
135 0.08
136 0.07
137 0.08
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.06
146 0.07
147 0.07
148 0.08
149 0.08
150 0.07
151 0.09
152 0.1
153 0.1
154 0.1
155 0.11
156 0.11
157 0.12
158 0.14
159 0.15
160 0.15
161 0.18
162 0.21
163 0.26
164 0.27
165 0.3
166 0.29
167 0.3
168 0.28
169 0.27
170 0.24
171 0.16
172 0.15
173 0.11
174 0.1
175 0.08
176 0.07
177 0.05
178 0.05
179 0.06
180 0.06
181 0.07
182 0.1
183 0.1
184 0.1
185 0.12
186 0.15
187 0.18
188 0.25
189 0.29
190 0.27
191 0.27
192 0.26
193 0.25
194 0.21
195 0.2
196 0.14
197 0.11
198 0.11
199 0.11
200 0.1
201 0.1
202 0.09
203 0.09
204 0.08
205 0.07
206 0.07
207 0.08
208 0.11
209 0.12
210 0.14
211 0.16
212 0.17
213 0.22
214 0.22
215 0.26
216 0.26
217 0.26
218 0.25
219 0.24
220 0.26
221 0.24
222 0.24
223 0.23
224 0.21
225 0.22
226 0.21
227 0.25
228 0.32
229 0.32
230 0.35
231 0.32
232 0.31
233 0.3
234 0.31
235 0.25
236 0.16
237 0.13
238 0.1
239 0.09
240 0.09
241 0.09
242 0.08
243 0.07
244 0.07
245 0.07
246 0.06
247 0.07
248 0.13
249 0.16
250 0.23
251 0.24
252 0.25
253 0.26
254 0.28
255 0.29
256 0.24
257 0.25
258 0.21
259 0.22
260 0.23
261 0.23
262 0.22
263 0.2
264 0.19
265 0.15
266 0.13
267 0.13
268 0.11
269 0.09
270 0.08
271 0.09
272 0.11
273 0.14
274 0.14
275 0.13
276 0.19
277 0.19
278 0.19
279 0.21
280 0.2
281 0.26
282 0.27
283 0.32
284 0.29
285 0.3
286 0.36