Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397ULI3

Protein Details
Accession A0A397ULI3    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-40NLRESNKSKNAKNRKLCKGNNTRINGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences MIQQEIDELDNREYNLRESNKSKNAKNRKLCKGNNTRINGLSYNSITKKYSFYWCENNKSCIKYFNTKDEQLKVFIKVIKFKIKLDKKLNNTSGTIQNQPRVYLKYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.27
3 0.28
4 0.32
5 0.35
6 0.43
7 0.49
8 0.55
9 0.59
10 0.62
11 0.69
12 0.73
13 0.79
14 0.8
15 0.81
16 0.85
17 0.84
18 0.84
19 0.83
20 0.83
21 0.81
22 0.76
23 0.68
24 0.59
25 0.57
26 0.47
27 0.37
28 0.3
29 0.23
30 0.22
31 0.2
32 0.2
33 0.18
34 0.18
35 0.19
36 0.19
37 0.25
38 0.24
39 0.27
40 0.34
41 0.38
42 0.45
43 0.46
44 0.48
45 0.45
46 0.44
47 0.41
48 0.37
49 0.37
50 0.37
51 0.38
52 0.42
53 0.44
54 0.46
55 0.49
56 0.48
57 0.46
58 0.42
59 0.4
60 0.33
61 0.31
62 0.29
63 0.28
64 0.29
65 0.32
66 0.37
67 0.38
68 0.4
69 0.47
70 0.53
71 0.6
72 0.64
73 0.68
74 0.67
75 0.75
76 0.77
77 0.69
78 0.63
79 0.58
80 0.56
81 0.52
82 0.52
83 0.45
84 0.46
85 0.45
86 0.45
87 0.45