Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TPZ1

Protein Details
Accession A0A397TPZ1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-73CEREKEKERESEKKRKKERVRKREKERKRKKEKEQKKESKRKRAKEKEQKRKRERREREKESDREKEKKBasic
NLS Segment(s)
PositionSequence
9-73KEKERESEKKRKKERVRKREKERKRKKEKEQKKESKRKRAKEKEQKRKRERREREKESDREKEKK
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MTFLCEREKEKERESEKKRKKERVRKREKERKRKKEKEQKKESKRKRAKEKEQKRKRERREREKESDREKEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.72
3 0.74
4 0.79
5 0.84
6 0.85
7 0.89
8 0.9
9 0.92
10 0.92
11 0.93
12 0.93
13 0.95
14 0.95
15 0.95
16 0.95
17 0.95
18 0.95
19 0.95
20 0.94
21 0.94
22 0.94
23 0.94
24 0.94
25 0.94
26 0.93
27 0.93
28 0.94
29 0.93
30 0.93
31 0.92
32 0.91
33 0.91
34 0.91
35 0.91
36 0.92
37 0.93
38 0.93
39 0.94
40 0.95
41 0.95
42 0.95
43 0.94
44 0.94
45 0.94
46 0.94
47 0.95
48 0.93
49 0.93
50 0.92
51 0.91
52 0.89
53 0.88