Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VHQ8

Protein Details
Accession A0A397VHQ8    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-86MEKSKRRDMKKVRSKKEWKNKEKGDEKSESKEEREERNGRKKKRKRKEAGGKRRERKKEKNERKKKEKMWEKKIKNKPNKEMREEEBasic
96-118KKWVVKGKKGTGGKKEKKEEKKEBasic
NLS Segment(s)
PositionSequence
3-118KSKRRDMKKVRSKKEWKNKEKGDEKSESKEEREERNGRKKKRKRKEAGGKRRERKKEKNERKKKEKMWEKKIKNKPNKEMREEEKEEEKEEKEKKWVVKGKKGTGGKKEKKEEKKE
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MEKSKRRDMKKVRSKKEWKNKEKGDEKSESKEEREERNGRKKKRKRKEAGGKRRERKKEKNERKKKEKMWEKKIKNKPNKEMREEEKEEEKEEKEKKWVVKGKKGTGGKKEKKEEKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.92
4 0.92
5 0.91
6 0.91
7 0.9
8 0.89
9 0.87
10 0.84
11 0.8
12 0.77
13 0.71
14 0.67
15 0.66
16 0.58
17 0.51
18 0.51
19 0.48
20 0.46
21 0.5
22 0.52
23 0.54
24 0.62
25 0.69
26 0.71
27 0.78
28 0.82
29 0.84
30 0.87
31 0.9
32 0.88
33 0.91
34 0.92
35 0.92
36 0.94
37 0.93
38 0.92
39 0.9
40 0.9
41 0.89
42 0.87
43 0.86
44 0.86
45 0.86
46 0.87
47 0.9
48 0.91
49 0.92
50 0.92
51 0.92
52 0.88
53 0.88
54 0.87
55 0.86
56 0.86
57 0.86
58 0.85
59 0.86
60 0.89
61 0.88
62 0.88
63 0.87
64 0.86
65 0.86
66 0.85
67 0.81
68 0.79
69 0.75
70 0.74
71 0.69
72 0.63
73 0.6
74 0.53
75 0.49
76 0.45
77 0.4
78 0.39
79 0.38
80 0.37
81 0.35
82 0.4
83 0.41
84 0.48
85 0.55
86 0.56
87 0.62
88 0.68
89 0.69
90 0.73
91 0.77
92 0.75
93 0.77
94 0.79
95 0.79
96 0.8
97 0.83
98 0.84