Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UQC6

Protein Details
Accession A0A397UQC6    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MVHNYRTTRSQKRNSSNVLFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007596  Pox_A_type_inc  
Pfam View protein in Pfam  
PF04508  Pox_A_type_inc  
Amino Acid Sequences MVHNYRTTRSQKRNSSNVLFGVIDTLQGENRRLLREVRRLKRRISELEEELEERRIRAVEWVTENWQQEERYSRLITERNRLRVRIDDLENRLTEARAGRNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.71
4 0.62
5 0.55
6 0.44
7 0.35
8 0.29
9 0.2
10 0.15
11 0.11
12 0.1
13 0.1
14 0.11
15 0.13
16 0.14
17 0.16
18 0.18
19 0.19
20 0.23
21 0.28
22 0.37
23 0.46
24 0.52
25 0.6
26 0.62
27 0.64
28 0.67
29 0.65
30 0.61
31 0.57
32 0.53
33 0.45
34 0.44
35 0.4
36 0.34
37 0.29
38 0.25
39 0.19
40 0.13
41 0.12
42 0.1
43 0.09
44 0.11
45 0.12
46 0.12
47 0.15
48 0.17
49 0.2
50 0.24
51 0.25
52 0.23
53 0.24
54 0.22
55 0.2
56 0.24
57 0.23
58 0.23
59 0.23
60 0.22
61 0.24
62 0.3
63 0.33
64 0.37
65 0.43
66 0.48
67 0.52
68 0.52
69 0.51
70 0.51
71 0.54
72 0.51
73 0.5
74 0.48
75 0.49
76 0.53
77 0.49
78 0.45
79 0.39
80 0.32
81 0.29
82 0.26