Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397U1U5

Protein Details
Accession A0A397U1U5    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
10-30KEYPKETRKNIKKLDLSNKNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 10, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025875  Leu-rich_rpt_4  
IPR032675  LRR_dom_sf  
Pfam View protein in Pfam  
PF12799  LRR_4  
Amino Acid Sequences MAKAQAIVDKEYPKETRKNIKKLDLSNKNLEGFLKLEGFSNLEVLNCSNNLLTDIDFADLNPETIKEIDLKNNKLSARFLTCFSKFVNLKSISIDSSFQGSLEPLKNLVKLNNITIAGTNIDHGLEYLPVSVISIGFDGILPGYEYFSLTSYTSEIHYDDYTPSHLFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.54
4 0.61
5 0.69
6 0.71
7 0.76
8 0.79
9 0.8
10 0.83
11 0.81
12 0.78
13 0.75
14 0.71
15 0.63
16 0.56
17 0.47
18 0.38
19 0.28
20 0.24
21 0.17
22 0.14
23 0.13
24 0.13
25 0.14
26 0.12
27 0.12
28 0.1
29 0.09
30 0.09
31 0.09
32 0.1
33 0.08
34 0.09
35 0.08
36 0.08
37 0.09
38 0.09
39 0.08
40 0.08
41 0.09
42 0.08
43 0.08
44 0.08
45 0.09
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.08
52 0.08
53 0.08
54 0.09
55 0.17
56 0.22
57 0.24
58 0.25
59 0.29
60 0.29
61 0.28
62 0.28
63 0.24
64 0.24
65 0.23
66 0.23
67 0.24
68 0.25
69 0.24
70 0.23
71 0.27
72 0.22
73 0.22
74 0.28
75 0.24
76 0.24
77 0.24
78 0.25
79 0.19
80 0.19
81 0.19
82 0.11
83 0.12
84 0.11
85 0.09
86 0.09
87 0.08
88 0.1
89 0.11
90 0.11
91 0.11
92 0.12
93 0.14
94 0.15
95 0.16
96 0.18
97 0.18
98 0.19
99 0.21
100 0.2
101 0.18
102 0.18
103 0.17
104 0.13
105 0.12
106 0.11
107 0.07
108 0.07
109 0.07
110 0.07
111 0.06
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.06
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.06
129 0.06
130 0.07
131 0.07
132 0.08
133 0.08
134 0.09
135 0.11
136 0.1
137 0.11
138 0.11
139 0.11
140 0.12
141 0.13
142 0.13
143 0.14
144 0.15
145 0.15
146 0.16
147 0.17
148 0.19