Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VJB8

Protein Details
Accession A0A397VJB8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
66-95YLHQYPLVQKRRRNRRRKEKKEEVEEENNDBasic
NLS Segment(s)
PositionSequence
75-86KRRRNRRRKEKK
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MKYKYQHSYLRHSFYYSIGNNNNNKNGNNDNDNNNNINNNIEIKRMEKELLVRKKQLKNHNDRLIYLHQYPLVQKRRRNRRRKEKKEEVEEENNDNNREIIIIDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.36
4 0.35
5 0.34
6 0.39
7 0.42
8 0.46
9 0.5
10 0.45
11 0.44
12 0.42
13 0.41
14 0.39
15 0.4
16 0.38
17 0.38
18 0.39
19 0.41
20 0.38
21 0.34
22 0.31
23 0.24
24 0.22
25 0.17
26 0.16
27 0.14
28 0.14
29 0.14
30 0.15
31 0.16
32 0.16
33 0.16
34 0.13
35 0.18
36 0.26
37 0.34
38 0.36
39 0.4
40 0.46
41 0.51
42 0.58
43 0.61
44 0.61
45 0.62
46 0.69
47 0.72
48 0.65
49 0.6
50 0.58
51 0.53
52 0.47
53 0.39
54 0.3
55 0.23
56 0.22
57 0.25
58 0.29
59 0.35
60 0.36
61 0.41
62 0.5
63 0.61
64 0.71
65 0.79
66 0.81
67 0.82
68 0.88
69 0.94
70 0.95
71 0.95
72 0.94
73 0.94
74 0.9
75 0.86
76 0.84
77 0.77
78 0.71
79 0.67
80 0.6
81 0.51
82 0.45
83 0.36
84 0.27
85 0.23
86 0.18