Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VFD3

Protein Details
Accession A0A397VFD3    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
153-173DDKPSKWWMCFQKRKFMNKSLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8.5, cyto_nucl 7.5, cyto 5.5, E.R. 4, mito 3, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007204  ARPC3  
IPR036753  ARPC3_sf  
Gene Ontology GO:0005885  C:Arp2/3 protein complex  
GO:0005737  C:cytoplasm  
GO:0003779  F:actin binding  
GO:0034314  P:Arp2/3 complex-mediated actin nucleation  
GO:0030833  P:regulation of actin filament polymerization  
Pfam View protein in Pfam  
PF04062  P21-Arc  
Amino Acid Sequences MPAYHSQFNERTEYRVVGNMVLLPIKTKVRGPATPAPPSDDDIIDEALDLFRANCLFRNFEIKGDADRVLIYLILFISDCLNKLIKNPSRKEALKILNTRATDNFALPGDPMFPLNALYAPPANRNDADLLRQYLGQLRQELVTRLVDRVYVDDKPSKWWMCFQKRKFMNKSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.3
4 0.22
5 0.22
6 0.19
7 0.17
8 0.16
9 0.15
10 0.12
11 0.14
12 0.15
13 0.16
14 0.17
15 0.23
16 0.28
17 0.31
18 0.37
19 0.43
20 0.47
21 0.52
22 0.5
23 0.48
24 0.43
25 0.43
26 0.38
27 0.28
28 0.23
29 0.19
30 0.18
31 0.13
32 0.12
33 0.1
34 0.07
35 0.07
36 0.06
37 0.04
38 0.05
39 0.06
40 0.06
41 0.1
42 0.12
43 0.14
44 0.15
45 0.22
46 0.22
47 0.22
48 0.24
49 0.21
50 0.21
51 0.21
52 0.2
53 0.13
54 0.13
55 0.12
56 0.1
57 0.09
58 0.07
59 0.05
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.06
67 0.07
68 0.07
69 0.07
70 0.1
71 0.19
72 0.23
73 0.31
74 0.33
75 0.35
76 0.41
77 0.42
78 0.43
79 0.42
80 0.44
81 0.43
82 0.44
83 0.44
84 0.42
85 0.42
86 0.4
87 0.33
88 0.3
89 0.23
90 0.2
91 0.18
92 0.13
93 0.12
94 0.11
95 0.1
96 0.07
97 0.07
98 0.07
99 0.06
100 0.06
101 0.06
102 0.07
103 0.07
104 0.06
105 0.07
106 0.09
107 0.1
108 0.14
109 0.15
110 0.17
111 0.17
112 0.18
113 0.21
114 0.2
115 0.22
116 0.21
117 0.22
118 0.2
119 0.2
120 0.19
121 0.21
122 0.23
123 0.23
124 0.21
125 0.2
126 0.21
127 0.23
128 0.24
129 0.21
130 0.22
131 0.2
132 0.2
133 0.19
134 0.19
135 0.17
136 0.2
137 0.21
138 0.18
139 0.21
140 0.26
141 0.27
142 0.31
143 0.39
144 0.39
145 0.37
146 0.43
147 0.5
148 0.55
149 0.65
150 0.65
151 0.68
152 0.73
153 0.82