Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TTV5

Protein Details
Accession A0A397TTV5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
14-34IYPSKNGGLRRKKKGENVTPAHydrophilic
NLS Segment(s)
PositionSequence
23-27RRKKK
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MFAPRSSRPATVAIYPSKNGGLRRKKKGENVTPAIELERILGLTTSKPTAISTAPVHDLVAYAADSVVVLYNHKKNKQVGFLHASSGVSSAPPPTSATFPNCCW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.34
4 0.33
5 0.33
6 0.34
7 0.39
8 0.44
9 0.5
10 0.6
11 0.67
12 0.7
13 0.76
14 0.81
15 0.8
16 0.79
17 0.75
18 0.68
19 0.6
20 0.54
21 0.46
22 0.35
23 0.26
24 0.16
25 0.11
26 0.07
27 0.06
28 0.06
29 0.05
30 0.06
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.09
37 0.08
38 0.11
39 0.1
40 0.11
41 0.13
42 0.12
43 0.12
44 0.1
45 0.1
46 0.07
47 0.07
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.03
54 0.05
55 0.04
56 0.05
57 0.09
58 0.16
59 0.22
60 0.25
61 0.3
62 0.34
63 0.4
64 0.47
65 0.47
66 0.48
67 0.49
68 0.47
69 0.44
70 0.4
71 0.35
72 0.26
73 0.23
74 0.16
75 0.1
76 0.1
77 0.1
78 0.09
79 0.1
80 0.12
81 0.14
82 0.17
83 0.21
84 0.27