Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VTM6

Protein Details
Accession A0A397VTM6    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
54-83EHMQKYPKYKYQPHRPHEKKMRTKRNSQFSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 12.5, mito 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences SFILYRQAKQPVIVAANKNISNNEVSKKVGDMWHKEPSEVKIKFQLLADIAKLEHMQKYPKYKYQPHRPHEKKMRTKRNSQFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.36
4 0.36
5 0.34
6 0.3
7 0.27
8 0.25
9 0.25
10 0.23
11 0.2
12 0.2
13 0.19
14 0.2
15 0.2
16 0.22
17 0.25
18 0.27
19 0.3
20 0.36
21 0.36
22 0.36
23 0.35
24 0.34
25 0.38
26 0.33
27 0.29
28 0.27
29 0.27
30 0.28
31 0.26
32 0.24
33 0.16
34 0.16
35 0.15
36 0.1
37 0.1
38 0.09
39 0.1
40 0.09
41 0.1
42 0.11
43 0.16
44 0.21
45 0.3
46 0.35
47 0.41
48 0.49
49 0.56
50 0.65
51 0.71
52 0.77
53 0.76
54 0.82
55 0.81
56 0.84
57 0.85
58 0.86
59 0.85
60 0.86
61 0.9
62 0.86
63 0.9