Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TRN0

Protein Details
Accession A0A397TRN0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-34LWAAPKKKTSHSKKRMRSANKGLKDKHydrophilic
NLS Segment(s)
PositionSequence
13-30PKKKTSHSKKRMRSANKG
Subcellular Location(s) mito 15, nucl 11.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences LAEVFEPFLWAAPKKKTSHSKKRMRSANKGLKDKTNIVNCPSCGQRRLTHHLCIYCYKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.42
3 0.51
4 0.59
5 0.67
6 0.73
7 0.77
8 0.8
9 0.87
10 0.88
11 0.85
12 0.84
13 0.83
14 0.82
15 0.8
16 0.77
17 0.7
18 0.65
19 0.61
20 0.55
21 0.51
22 0.48
23 0.42
24 0.4
25 0.42
26 0.38
27 0.37
28 0.38
29 0.35
30 0.31
31 0.33
32 0.35
33 0.39
34 0.48
35 0.49
36 0.51
37 0.54
38 0.55
39 0.55