Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UZX4

Protein Details
Accession A0A397UZX4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
34-62QLPEHAKPSSKNKKKQKKQYKISGLIRKLHydrophilic
NLS Segment(s)
PositionSequence
40-52KPSSKNKKKQKKQ
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MSRKRSQKQAKAQPSASQSSNSTQTQELESDDEQLPEHAKPSSKNKKKQKKQYKISGLIRKLITDTSNNNEWEPVEVIEAEGPTESIGKYLADLYKAASDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.65
3 0.56
4 0.47
5 0.39
6 0.35
7 0.38
8 0.32
9 0.29
10 0.25
11 0.25
12 0.23
13 0.22
14 0.19
15 0.17
16 0.16
17 0.18
18 0.17
19 0.16
20 0.14
21 0.14
22 0.15
23 0.11
24 0.12
25 0.1
26 0.11
27 0.15
28 0.25
29 0.36
30 0.44
31 0.53
32 0.63
33 0.73
34 0.81
35 0.89
36 0.89
37 0.89
38 0.89
39 0.9
40 0.89
41 0.87
42 0.86
43 0.84
44 0.74
45 0.69
46 0.6
47 0.49
48 0.4
49 0.32
50 0.25
51 0.19
52 0.2
53 0.2
54 0.24
55 0.25
56 0.24
57 0.23
58 0.22
59 0.21
60 0.19
61 0.15
62 0.11
63 0.1
64 0.1
65 0.1
66 0.1
67 0.08
68 0.07
69 0.06
70 0.06
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.07
77 0.11
78 0.12
79 0.13
80 0.13
81 0.15