Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UJB2

Protein Details
Accession A0A397UJB2    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
92-112GRLLQEKKQLKIRKKSKKALAHydrophilic
NLS Segment(s)
PositionSequence
95-112LQEKKQLKIRKKSKKALA
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MTPGTTTPETMTPKTMTPKMTISRKEVSKKREISTPTTTTTPRKEASKKREKILTPTTISKTTTSKKQRFQEQQLQEQRLQERRLQERRLQGRLLQEKKQLKIRKKSKKALA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.35
4 0.33
5 0.38
6 0.42
7 0.49
8 0.49
9 0.48
10 0.51
11 0.56
12 0.63
13 0.63
14 0.62
15 0.63
16 0.64
17 0.61
18 0.6
19 0.57
20 0.54
21 0.55
22 0.51
23 0.44
24 0.41
25 0.41
26 0.39
27 0.4
28 0.37
29 0.32
30 0.35
31 0.41
32 0.48
33 0.56
34 0.62
35 0.62
36 0.62
37 0.67
38 0.62
39 0.61
40 0.58
41 0.53
42 0.46
43 0.45
44 0.43
45 0.38
46 0.38
47 0.32
48 0.29
49 0.27
50 0.33
51 0.39
52 0.44
53 0.5
54 0.56
55 0.64
56 0.68
57 0.73
58 0.74
59 0.7
60 0.73
61 0.73
62 0.7
63 0.62
64 0.58
65 0.54
66 0.51
67 0.47
68 0.41
69 0.41
70 0.47
71 0.53
72 0.54
73 0.55
74 0.59
75 0.64
76 0.65
77 0.59
78 0.53
79 0.55
80 0.6
81 0.59
82 0.55
83 0.57
84 0.59
85 0.62
86 0.68
87 0.67
88 0.67
89 0.72
90 0.77
91 0.8
92 0.83