Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397V9I2

Protein Details
Accession A0A397V9I2    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MSKRSRKRKLNKKQKKKLLSKIPKFKNTLRBasic
NLS Segment(s)
PositionSequence
3-26KRSRKRKLNKKQKKKLLSKIPKFK
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MSKRSRKRKLNKKQKKKLLSKIPKFKNTLRKYINPTEEILMQKPIEEIQLDIEITIKELISHCLPTSNYRLEQTLIVLQQALSVNSLIPNDTAIFVHEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.95
3 0.95
4 0.94
5 0.94
6 0.93
7 0.93
8 0.92
9 0.91
10 0.88
11 0.83
12 0.8
13 0.79
14 0.74
15 0.73
16 0.69
17 0.67
18 0.66
19 0.69
20 0.66
21 0.57
22 0.53
23 0.44
24 0.41
25 0.36
26 0.29
27 0.22
28 0.17
29 0.16
30 0.14
31 0.13
32 0.1
33 0.08
34 0.07
35 0.06
36 0.07
37 0.07
38 0.06
39 0.07
40 0.06
41 0.06
42 0.06
43 0.05
44 0.05
45 0.05
46 0.08
47 0.08
48 0.09
49 0.09
50 0.12
51 0.13
52 0.16
53 0.2
54 0.22
55 0.23
56 0.23
57 0.25
58 0.23
59 0.22
60 0.21
61 0.2
62 0.16
63 0.15
64 0.13
65 0.12
66 0.14
67 0.15
68 0.13
69 0.1
70 0.1
71 0.1
72 0.11
73 0.12
74 0.09
75 0.08
76 0.09
77 0.09
78 0.1
79 0.1