Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397U9P9

Protein Details
Accession A0A397U9P9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
62-90HMQKYPEYKYQPRRPHEKKRRTKRNSQFSBasic
NLS Segment(s)
PositionSequence
73-85PRRPHEKKRRTKR
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences KTSRPPNAFILYHQAKQPVIVAANKNISNNEVSKKVGDMWHKEPSEVKIKFQLLADIAKLEHMQKYPEYKYQPRRPHEKKRRTKRNSQFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.3
3 0.3
4 0.3
5 0.22
6 0.2
7 0.22
8 0.22
9 0.23
10 0.28
11 0.29
12 0.28
13 0.25
14 0.24
15 0.22
16 0.22
17 0.21
18 0.18
19 0.18
20 0.17
21 0.18
22 0.18
23 0.2
24 0.23
25 0.25
26 0.28
27 0.34
28 0.34
29 0.34
30 0.33
31 0.32
32 0.37
33 0.32
34 0.28
35 0.26
36 0.27
37 0.28
38 0.26
39 0.25
40 0.16
41 0.17
42 0.16
43 0.11
44 0.1
45 0.1
46 0.1
47 0.09
48 0.11
49 0.11
50 0.13
51 0.15
52 0.21
53 0.24
54 0.3
55 0.36
56 0.43
57 0.53
58 0.62
59 0.68
60 0.7
61 0.78
62 0.81
63 0.86
64 0.87
65 0.88
66 0.89
67 0.91
68 0.94
69 0.92
70 0.93