Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397V924

Protein Details
Accession A0A397V924    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-35LEASKKPSSHCWKSSHRKTYRNRKRYEEPLAYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.833, mito_nucl 13.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
Amino Acid Sequences MRNLEASKKPSSHCWKSSHRKTYRNRKRYEEPLAYLNKPLEINPNNVNVLENHRETYCIMVNRCEESLSDLNKSLKIILNNIEALAYRKSTYLMMNRFEEYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.66
3 0.73
4 0.82
5 0.82
6 0.81
7 0.81
8 0.85
9 0.89
10 0.9
11 0.88
12 0.84
13 0.82
14 0.82
15 0.81
16 0.8
17 0.75
18 0.66
19 0.63
20 0.62
21 0.54
22 0.48
23 0.39
24 0.31
25 0.25
26 0.22
27 0.24
28 0.21
29 0.23
30 0.23
31 0.25
32 0.24
33 0.24
34 0.24
35 0.16
36 0.19
37 0.19
38 0.17
39 0.15
40 0.15
41 0.16
42 0.15
43 0.17
44 0.16
45 0.16
46 0.16
47 0.18
48 0.19
49 0.2
50 0.2
51 0.18
52 0.15
53 0.18
54 0.22
55 0.2
56 0.21
57 0.22
58 0.23
59 0.24
60 0.24
61 0.2
62 0.19
63 0.18
64 0.19
65 0.2
66 0.22
67 0.21
68 0.21
69 0.19
70 0.16
71 0.17
72 0.17
73 0.14
74 0.12
75 0.12
76 0.14
77 0.15
78 0.2
79 0.27
80 0.31
81 0.34
82 0.37