Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VSZ1

Protein Details
Accession A0A397VSZ1    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MRRSTKRSTRKSTKRSTRRSIRKSTRRSTGQKQDEHydrophilic
67-86GEHKKTKNLSTKKLQRRTTEHydrophilic
NLS Segment(s)
PositionSequence
3-30RSTKRSTRKSTKRSTRRSIRKSTRRSTG
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MRRSTKRSTRKSTKRSTRRSIRKSTRRSTGQKQDEIRDDEKQHKSPPKNNKEEPPKDLQNLPKNVLGEHKKTKNLSTKKLQRRTTEGLEPTDEKTKNLSAEKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.92
4 0.92
5 0.92
6 0.91
7 0.91
8 0.91
9 0.91
10 0.9
11 0.87
12 0.86
13 0.84
14 0.83
15 0.81
16 0.81
17 0.79
18 0.76
19 0.72
20 0.68
21 0.64
22 0.62
23 0.54
24 0.49
25 0.44
26 0.45
27 0.46
28 0.44
29 0.45
30 0.48
31 0.51
32 0.54
33 0.62
34 0.63
35 0.67
36 0.68
37 0.7
38 0.72
39 0.7
40 0.67
41 0.63
42 0.56
43 0.5
44 0.5
45 0.49
46 0.46
47 0.45
48 0.43
49 0.38
50 0.35
51 0.34
52 0.37
53 0.34
54 0.32
55 0.37
56 0.4
57 0.43
58 0.44
59 0.51
60 0.53
61 0.57
62 0.58
63 0.6
64 0.66
65 0.72
66 0.8
67 0.8
68 0.76
69 0.76
70 0.75
71 0.71
72 0.69
73 0.62
74 0.55
75 0.53
76 0.48
77 0.44
78 0.45
79 0.39
80 0.31
81 0.32
82 0.32
83 0.34