Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397USR2

Protein Details
Accession A0A397USR2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
106-131LDYSPKKENKSDKKLSRKKIRSLLVKHydrophilic
NLS Segment(s)
PositionSequence
111-126KKENKSDKKLSRKKIR
Subcellular Location(s) nucl 14.5, cyto_nucl 14, cyto 12.5
Family & Domain DBs
Amino Acid Sequences MSHVPGNDENLTEPDIGDIYRDSLKACEEYDACLTTTIYGETYLNPEKCKARGFDPIKACEEEEERTNLSIEWIERTTKEKGFRAQFQEFIAKVPPKYVSKDLKFLDYSPKKENKSDKKLSRKKIRSLLVKASYLVDHKIKLENGLYVKVIAVKMNNENVFLEVEEKVGDELEYYEILYQRDMVEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.11
4 0.11
5 0.09
6 0.1
7 0.12
8 0.12
9 0.12
10 0.13
11 0.15
12 0.16
13 0.16
14 0.18
15 0.16
16 0.19
17 0.21
18 0.21
19 0.19
20 0.18
21 0.18
22 0.14
23 0.14
24 0.12
25 0.09
26 0.09
27 0.09
28 0.09
29 0.14
30 0.2
31 0.21
32 0.21
33 0.25
34 0.27
35 0.29
36 0.32
37 0.29
38 0.27
39 0.36
40 0.39
41 0.44
42 0.46
43 0.48
44 0.47
45 0.45
46 0.42
47 0.33
48 0.31
49 0.25
50 0.21
51 0.19
52 0.17
53 0.16
54 0.17
55 0.14
56 0.13
57 0.12
58 0.1
59 0.11
60 0.11
61 0.11
62 0.12
63 0.15
64 0.18
65 0.21
66 0.25
67 0.25
68 0.31
69 0.34
70 0.39
71 0.43
72 0.41
73 0.39
74 0.36
75 0.36
76 0.3
77 0.26
78 0.25
79 0.19
80 0.17
81 0.17
82 0.19
83 0.17
84 0.2
85 0.26
86 0.31
87 0.31
88 0.38
89 0.37
90 0.38
91 0.37
92 0.34
93 0.38
94 0.35
95 0.37
96 0.38
97 0.44
98 0.43
99 0.48
100 0.57
101 0.57
102 0.61
103 0.67
104 0.69
105 0.74
106 0.81
107 0.85
108 0.86
109 0.84
110 0.83
111 0.81
112 0.8
113 0.78
114 0.75
115 0.74
116 0.68
117 0.61
118 0.53
119 0.45
120 0.39
121 0.31
122 0.28
123 0.2
124 0.17
125 0.17
126 0.2
127 0.19
128 0.21
129 0.2
130 0.21
131 0.21
132 0.22
133 0.2
134 0.17
135 0.17
136 0.17
137 0.16
138 0.13
139 0.13
140 0.15
141 0.18
142 0.25
143 0.25
144 0.24
145 0.24
146 0.24
147 0.23
148 0.2
149 0.18
150 0.11
151 0.11
152 0.1
153 0.1
154 0.09
155 0.08
156 0.08
157 0.06
158 0.07
159 0.08
160 0.08
161 0.08
162 0.11
163 0.12
164 0.13
165 0.13
166 0.13