Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VC53

Protein Details
Accession A0A397VC53    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
103-128PDYSPKKGNKSDKKLSRKKIRSLLVKHydrophilic
NLS Segment(s)
PositionSequence
107-123PKKGNKSDKKLSRKKIR
Subcellular Location(s) nucl 14.5, cyto_nucl 13.333, cyto 10, mito_nucl 8.666
Family & Domain DBs
Amino Acid Sequences MSHVPGNDKKPDIGDIYRESQKAYEEYNACLTTTIYGETYLDPEKCKARGFDPIKACEEEEERTNLSVEWIERTTKEKGFRAQFQEFIAKVPPEYVSKDPKFPDYSPKKGNKSDKKLSRKKIRSLLVKASDLVDHKIKLEDGLYVKVIAVKMNNDNVFLEVEEKVGDELEYYEILYQQDMVGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.36
4 0.4
5 0.38
6 0.36
7 0.32
8 0.32
9 0.29
10 0.27
11 0.28
12 0.24
13 0.27
14 0.31
15 0.3
16 0.27
17 0.25
18 0.23
19 0.16
20 0.15
21 0.14
22 0.09
23 0.09
24 0.1
25 0.1
26 0.12
27 0.14
28 0.15
29 0.15
30 0.17
31 0.21
32 0.22
33 0.24
34 0.24
35 0.22
36 0.32
37 0.35
38 0.4
39 0.42
40 0.44
41 0.45
42 0.44
43 0.42
44 0.34
45 0.31
46 0.25
47 0.21
48 0.2
49 0.17
50 0.17
51 0.17
52 0.15
53 0.13
54 0.12
55 0.11
56 0.11
57 0.11
58 0.11
59 0.12
60 0.16
61 0.18
62 0.21
63 0.25
64 0.25
65 0.31
66 0.35
67 0.4
68 0.43
69 0.41
70 0.39
71 0.36
72 0.37
73 0.3
74 0.26
75 0.23
76 0.16
77 0.14
78 0.13
79 0.13
80 0.1
81 0.13
82 0.16
83 0.23
84 0.24
85 0.28
86 0.28
87 0.31
88 0.33
89 0.31
90 0.38
91 0.37
92 0.43
93 0.47
94 0.54
95 0.56
96 0.6
97 0.7
98 0.69
99 0.71
100 0.74
101 0.76
102 0.79
103 0.83
104 0.85
105 0.86
106 0.84
107 0.83
108 0.82
109 0.8
110 0.78
111 0.75
112 0.74
113 0.68
114 0.61
115 0.53
116 0.45
117 0.39
118 0.31
119 0.28
120 0.22
121 0.17
122 0.17
123 0.18
124 0.17
125 0.15
126 0.14
127 0.15
128 0.14
129 0.16
130 0.15
131 0.14
132 0.14
133 0.16
134 0.16
135 0.13
136 0.13
137 0.14
138 0.17
139 0.24
140 0.25
141 0.23
142 0.24
143 0.23
144 0.23
145 0.19
146 0.18
147 0.11
148 0.11
149 0.1
150 0.1
151 0.09
152 0.08
153 0.08
154 0.06
155 0.07
156 0.08
157 0.08
158 0.08
159 0.09
160 0.1
161 0.11
162 0.1
163 0.1