Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397V7U6

Protein Details
Accession A0A397V7U6    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
40-63GTTTRMVKRKEKEKKKQEIEELKNBasic
NLS Segment(s)
PositionSequence
47-57KRKEKEKKKQE
78-87TKRNKNGKVT
Subcellular Location(s) mito_nucl 12, nucl 11.5, mito 11.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSTTLPTFSNIITSNLVYVIPGVRISSHTAASTTLEKETGTTTRMVKRKEKEKKKQEIEELKNKNEQEEKENGTRMATKRNKNGKVTKIGKNPQKNDKNDEEEPTIELAGKLLRNGEKHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.11
5 0.11
6 0.09
7 0.08
8 0.08
9 0.07
10 0.08
11 0.09
12 0.14
13 0.15
14 0.15
15 0.15
16 0.15
17 0.15
18 0.17
19 0.18
20 0.15
21 0.13
22 0.12
23 0.12
24 0.12
25 0.14
26 0.13
27 0.11
28 0.12
29 0.15
30 0.22
31 0.28
32 0.32
33 0.37
34 0.43
35 0.52
36 0.61
37 0.68
38 0.72
39 0.78
40 0.84
41 0.84
42 0.83
43 0.82
44 0.82
45 0.78
46 0.77
47 0.71
48 0.62
49 0.59
50 0.52
51 0.45
52 0.39
53 0.34
54 0.28
55 0.29
56 0.31
57 0.29
58 0.31
59 0.28
60 0.25
61 0.29
62 0.25
63 0.31
64 0.35
65 0.38
66 0.47
67 0.57
68 0.62
69 0.65
70 0.72
71 0.68
72 0.71
73 0.72
74 0.71
75 0.7
76 0.73
77 0.74
78 0.75
79 0.75
80 0.76
81 0.78
82 0.74
83 0.72
84 0.72
85 0.7
86 0.64
87 0.62
88 0.54
89 0.46
90 0.42
91 0.36
92 0.28
93 0.21
94 0.17
95 0.13
96 0.13
97 0.13
98 0.12
99 0.16
100 0.2