Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TXY5

Protein Details
Accession A0A397TXY5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
236-258RASRMSKRSGLLHRRKQKTFKNGHydrophilic
NLS Segment(s)
PositionSequence
225-256SASRRRSTNNNRASRMSKRSGLLHRRKQKTFK
Subcellular Location(s) nucl 19.5, cyto_nucl 15, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MRVCNFCRHLMEDYGDNSDAETEHWTTEKNDFPNNPLSRSQSILTDNHNIPSSTTSELTPTLNAHLSPRPPSPDALSLNDFDLKRITSLFMSRSRSNTINEDSHIISSPSPPAPFRRSLAEDDKNTPAANPEAVLDPEIAPFMSDEEGEDDVHYDSLTNPSNVLNFVTSFLHVGGNNDSATPTPAVSEYAGSDDDVSEYGSRPLRSIQRGQRADEIRSQFARDKSASRRRSTNNNRASRMSKRSGLLHRRKQKTFKNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.27
4 0.23
5 0.2
6 0.17
7 0.14
8 0.15
9 0.12
10 0.12
11 0.13
12 0.14
13 0.16
14 0.21
15 0.26
16 0.26
17 0.32
18 0.32
19 0.36
20 0.45
21 0.45
22 0.44
23 0.41
24 0.44
25 0.39
26 0.41
27 0.37
28 0.32
29 0.33
30 0.32
31 0.32
32 0.33
33 0.32
34 0.32
35 0.32
36 0.28
37 0.25
38 0.25
39 0.22
40 0.18
41 0.18
42 0.16
43 0.16
44 0.17
45 0.17
46 0.16
47 0.14
48 0.14
49 0.14
50 0.14
51 0.15
52 0.18
53 0.2
54 0.23
55 0.25
56 0.28
57 0.28
58 0.29
59 0.3
60 0.32
61 0.33
62 0.33
63 0.32
64 0.27
65 0.28
66 0.31
67 0.27
68 0.21
69 0.19
70 0.15
71 0.14
72 0.13
73 0.13
74 0.1
75 0.12
76 0.16
77 0.2
78 0.25
79 0.27
80 0.29
81 0.32
82 0.33
83 0.33
84 0.33
85 0.32
86 0.28
87 0.27
88 0.27
89 0.23
90 0.22
91 0.2
92 0.16
93 0.12
94 0.11
95 0.13
96 0.12
97 0.12
98 0.12
99 0.16
100 0.2
101 0.22
102 0.22
103 0.25
104 0.26
105 0.3
106 0.37
107 0.38
108 0.36
109 0.37
110 0.37
111 0.33
112 0.3
113 0.25
114 0.19
115 0.14
116 0.11
117 0.08
118 0.07
119 0.08
120 0.08
121 0.08
122 0.07
123 0.07
124 0.07
125 0.07
126 0.06
127 0.05
128 0.05
129 0.05
130 0.05
131 0.04
132 0.04
133 0.06
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.07
140 0.07
141 0.05
142 0.05
143 0.09
144 0.1
145 0.09
146 0.1
147 0.1
148 0.11
149 0.11
150 0.11
151 0.08
152 0.07
153 0.09
154 0.09
155 0.09
156 0.09
157 0.09
158 0.1
159 0.09
160 0.11
161 0.11
162 0.12
163 0.12
164 0.11
165 0.11
166 0.1
167 0.11
168 0.1
169 0.08
170 0.07
171 0.08
172 0.09
173 0.09
174 0.09
175 0.08
176 0.09
177 0.1
178 0.09
179 0.09
180 0.08
181 0.08
182 0.08
183 0.08
184 0.07
185 0.07
186 0.11
187 0.15
188 0.15
189 0.15
190 0.21
191 0.27
192 0.32
193 0.4
194 0.46
195 0.52
196 0.55
197 0.58
198 0.61
199 0.58
200 0.56
201 0.54
202 0.5
203 0.45
204 0.43
205 0.43
206 0.41
207 0.39
208 0.41
209 0.36
210 0.38
211 0.43
212 0.52
213 0.56
214 0.56
215 0.63
216 0.63
217 0.72
218 0.76
219 0.77
220 0.77
221 0.78
222 0.77
223 0.75
224 0.75
225 0.73
226 0.7
227 0.66
228 0.62
229 0.57
230 0.6
231 0.65
232 0.7
233 0.71
234 0.74
235 0.77
236 0.81
237 0.86
238 0.88