Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UYZ4

Protein Details
Accession A0A397UYZ4    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-37RNRISKGYYFWKKRQHKRFSKQKQQQEKQQLYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 4.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MVFFFRNRISKGYYFWKKRQHKRFSKQKQQQEKQQLYQQWNGIVKSISALLIESNHSFSLETWTIITLLFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.66
4 0.71
5 0.79
6 0.85
7 0.85
8 0.86
9 0.88
10 0.92
11 0.92
12 0.93
13 0.92
14 0.92
15 0.92
16 0.88
17 0.87
18 0.86
19 0.8
20 0.72
21 0.68
22 0.63
23 0.55
24 0.51
25 0.43
26 0.36
27 0.33
28 0.29
29 0.25
30 0.2
31 0.16
32 0.13
33 0.13
34 0.09
35 0.06
36 0.06
37 0.06
38 0.07
39 0.09
40 0.09
41 0.11
42 0.1
43 0.11
44 0.11
45 0.11
46 0.18
47 0.17
48 0.17
49 0.15
50 0.16
51 0.16