Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UAE4

Protein Details
Accession A0A397UAE4    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MTTPRKEAPKKKEKREVSARNKKQKTNSKKPLKLMKISHydrophilic
77-100TTSKTMTSKTRPQKQRLQEQRLQEHydrophilic
NLS Segment(s)
PositionSequence
5-33RKEAPKKKEKREVSARNKKQKTNSKKPLK
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
Amino Acid Sequences MTTPRKEAPKKKEKREVSARNKKQKTNSKKPLKLMKISTPTTIPKMTTPRTMTPRTMTPKTTTPKTTTPRITTPKTTTSKTMTSKTRPQKQRLQEQRLQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.88
4 0.88
5 0.89
6 0.89
7 0.89
8 0.88
9 0.85
10 0.84
11 0.83
12 0.83
13 0.83
14 0.83
15 0.83
16 0.83
17 0.85
18 0.86
19 0.81
20 0.78
21 0.71
22 0.69
23 0.65
24 0.6
25 0.53
26 0.46
27 0.41
28 0.37
29 0.33
30 0.25
31 0.22
32 0.26
33 0.26
34 0.29
35 0.31
36 0.33
37 0.38
38 0.4
39 0.38
40 0.35
41 0.39
42 0.4
43 0.39
44 0.36
45 0.34
46 0.38
47 0.42
48 0.44
49 0.4
50 0.39
51 0.44
52 0.47
53 0.52
54 0.51
55 0.51
56 0.54
57 0.58
58 0.58
59 0.56
60 0.56
61 0.57
62 0.56
63 0.53
64 0.49
65 0.47
66 0.5
67 0.49
68 0.51
69 0.5
70 0.53
71 0.61
72 0.67
73 0.72
74 0.74
75 0.76
76 0.79
77 0.81
78 0.85
79 0.86
80 0.84