Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UAG6

Protein Details
Accession A0A397UAG6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
31-52SAVSIKKQRQYRQYMNRRGGFNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences DEDPEKALMVIMGMSGFGTTKGKKVLGNEASAVSIKKQRQYRQYMNRRGGFNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.07
6 0.08
7 0.1
8 0.12
9 0.13
10 0.15
11 0.17
12 0.25
13 0.25
14 0.25
15 0.24
16 0.22
17 0.22
18 0.21
19 0.19
20 0.12
21 0.16
22 0.18
23 0.23
24 0.31
25 0.37
26 0.46
27 0.56
28 0.65
29 0.7
30 0.78
31 0.82
32 0.84
33 0.83