Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397W364

Protein Details
Accession A0A397W364    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-56EGTGRHQQHKNKAKNKYDKNPYKIIQQQLKHRKEKTNKPKDNQENKICHydrophilic
NLS Segment(s)
PositionSequence
40-43RKEK
60-66GKAPRKK
Subcellular Location(s) nucl 18, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MTPNNISDEGTGRHQQHKNKAKNKYDKNPYKIIQQQLKHRKEKTNKPKDNQENKICDFKGKAPRKKAMKSIMTQISTTIPMAVPITTPMMAQMTTPTVLAMTPKSDPSNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.49
3 0.56
4 0.64
5 0.69
6 0.71
7 0.78
8 0.79
9 0.84
10 0.87
11 0.87
12 0.88
13 0.87
14 0.84
15 0.82
16 0.74
17 0.72
18 0.68
19 0.66
20 0.63
21 0.58
22 0.63
23 0.65
24 0.72
25 0.7
26 0.69
27 0.7
28 0.71
29 0.78
30 0.78
31 0.79
32 0.79
33 0.77
34 0.82
35 0.83
36 0.84
37 0.82
38 0.78
39 0.72
40 0.66
41 0.66
42 0.56
43 0.46
44 0.38
45 0.36
46 0.39
47 0.43
48 0.48
49 0.49
50 0.57
51 0.63
52 0.66
53 0.67
54 0.65
55 0.61
56 0.57
57 0.58
58 0.57
59 0.5
60 0.46
61 0.39
62 0.32
63 0.26
64 0.24
65 0.17
66 0.1
67 0.09
68 0.1
69 0.09
70 0.07
71 0.08
72 0.1
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.1
80 0.1
81 0.11
82 0.11
83 0.1
84 0.09
85 0.09
86 0.11
87 0.11
88 0.12
89 0.13
90 0.17