Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VIP3

Protein Details
Accession A0A397VIP3    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-43KIKIIKKRNKPFKRHQSDRYKSVKESWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
3-44KIIKKRNKPFKRHQSDRYKSVKESWRKPKGIDNRVRRRFKGQ
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences KIKIIKKRNKPFKRHQSDRYKSVKESWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRYLMPNGFKKFLVSNVKELELLLMHNKTYAAEIAHNVSSRKRIAIIDRAQQLNVRVINAKARVRTQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.91
4 0.89
5 0.89
6 0.87
7 0.8
8 0.72
9 0.71
10 0.7
11 0.68
12 0.7
13 0.71
14 0.72
15 0.69
16 0.69
17 0.7
18 0.71
19 0.72
20 0.71
21 0.71
22 0.73
23 0.8
24 0.84
25 0.77
26 0.74
27 0.71
28 0.68
29 0.68
30 0.65
31 0.65
32 0.64
33 0.66
34 0.6
35 0.53
36 0.46
37 0.38
38 0.38
39 0.33
40 0.35
41 0.4
42 0.41
43 0.41
44 0.42
45 0.44
46 0.42
47 0.44
48 0.44
49 0.42
50 0.49
51 0.51
52 0.5
53 0.46
54 0.42
55 0.34
56 0.33
57 0.34
58 0.27
59 0.29
60 0.29
61 0.29
62 0.28
63 0.27
64 0.21
65 0.13
66 0.12
67 0.1
68 0.09
69 0.08
70 0.09
71 0.09
72 0.09
73 0.09
74 0.1
75 0.08
76 0.08
77 0.1
78 0.12
79 0.14
80 0.16
81 0.16
82 0.17
83 0.2
84 0.2
85 0.2
86 0.19
87 0.21
88 0.25
89 0.33
90 0.38
91 0.41
92 0.46
93 0.47
94 0.45
95 0.44
96 0.41
97 0.37
98 0.33
99 0.27
100 0.23
101 0.24
102 0.3
103 0.34
104 0.37
105 0.35