Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397U4D5

Protein Details
Accession A0A397U4D5    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MTRKSAVTTHKKNKLQAKKNLSKKSKSKIITHydrophilic
NLS Segment(s)
PositionSequence
11-27KKNKLQAKKNLSKKSKS
Subcellular Location(s) nucl 20, mito 6
Family & Domain DBs
Amino Acid Sequences MTRKSAVTTHKKNKLQAKKNLSKKSKSKIITISDSETEATSSKKPKIKSESNELHELEIEERKIMIKERAVAIHKKEIDIRKKEAEIEALELANKKMRNDLEHAKQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.81
4 0.82
5 0.81
6 0.86
7 0.89
8 0.86
9 0.85
10 0.83
11 0.82
12 0.8
13 0.73
14 0.69
15 0.67
16 0.65
17 0.61
18 0.55
19 0.5
20 0.41
21 0.39
22 0.33
23 0.25
24 0.2
25 0.14
26 0.13
27 0.13
28 0.16
29 0.21
30 0.25
31 0.27
32 0.34
33 0.42
34 0.49
35 0.5
36 0.56
37 0.58
38 0.57
39 0.59
40 0.52
41 0.44
42 0.35
43 0.31
44 0.23
45 0.16
46 0.13
47 0.08
48 0.08
49 0.09
50 0.09
51 0.11
52 0.12
53 0.12
54 0.15
55 0.17
56 0.21
57 0.24
58 0.28
59 0.29
60 0.34
61 0.33
62 0.32
63 0.36
64 0.4
65 0.46
66 0.48
67 0.5
68 0.47
69 0.48
70 0.49
71 0.44
72 0.39
73 0.31
74 0.29
75 0.25
76 0.2
77 0.2
78 0.19
79 0.19
80 0.2
81 0.2
82 0.17
83 0.23
84 0.26
85 0.29
86 0.35
87 0.43