Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VSE1

Protein Details
Accession A0A397VSE1    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
7-38TPETKEVSKDKNPRKKNEKHRKKDIEKAPNSDBasic
NLS Segment(s)
PositionSequence
15-30KDKNPRKKNEKHRKKD
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MALPMTTPETKEVSKDKNPRKKNEKHRKKDIEKAPNSDTNDDTRDERSIERQEPMKEGRKAPEKRYVLDTDEKEKAPNGDTNDDTRDERGIKRQEPMKEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.51
3 0.59
4 0.66
5 0.74
6 0.8
7 0.83
8 0.86
9 0.88
10 0.89
11 0.9
12 0.9
13 0.92
14 0.93
15 0.9
16 0.9
17 0.88
18 0.88
19 0.82
20 0.78
21 0.72
22 0.67
23 0.62
24 0.54
25 0.45
26 0.37
27 0.33
28 0.28
29 0.24
30 0.2
31 0.18
32 0.17
33 0.16
34 0.18
35 0.21
36 0.21
37 0.22
38 0.24
39 0.24
40 0.27
41 0.31
42 0.34
43 0.33
44 0.33
45 0.38
46 0.44
47 0.48
48 0.49
49 0.54
50 0.48
51 0.46
52 0.5
53 0.46
54 0.41
55 0.44
56 0.42
57 0.38
58 0.39
59 0.37
60 0.33
61 0.31
62 0.29
63 0.24
64 0.26
65 0.25
66 0.26
67 0.28
68 0.3
69 0.32
70 0.33
71 0.31
72 0.28
73 0.28
74 0.26
75 0.27
76 0.33
77 0.38
78 0.39
79 0.45
80 0.5