Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UTR1

Protein Details
Accession A0A397UTR1    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
114-133RGTPSNSTIKPRPKPWEKRKBasic
NLS Segment(s)
PositionSequence
123-133KPRPKPWEKRK
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 2, pero 2
Family & Domain DBs
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences FIKFEQYDFDKDQDFQAGLPSILASYQNNSQEELDKLQEKAKWFYFSKVVQKFDYNEYLAWKSNKSSAFELSNNQNTPRQDVKTDGKTFQQLAEMIRTNQPIPGIKNIPDEINRGTPSNSTIKPRPKPWEKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.18
3 0.19
4 0.18
5 0.15
6 0.14
7 0.13
8 0.1
9 0.1
10 0.11
11 0.08
12 0.1
13 0.15
14 0.2
15 0.2
16 0.22
17 0.22
18 0.23
19 0.25
20 0.24
21 0.23
22 0.2
23 0.2
24 0.22
25 0.24
26 0.24
27 0.27
28 0.27
29 0.3
30 0.29
31 0.31
32 0.33
33 0.35
34 0.42
35 0.43
36 0.42
37 0.38
38 0.39
39 0.39
40 0.37
41 0.35
42 0.27
43 0.22
44 0.22
45 0.22
46 0.22
47 0.21
48 0.18
49 0.16
50 0.2
51 0.21
52 0.21
53 0.21
54 0.2
55 0.23
56 0.23
57 0.25
58 0.25
59 0.27
60 0.25
61 0.25
62 0.27
63 0.24
64 0.28
65 0.29
66 0.26
67 0.23
68 0.28
69 0.32
70 0.37
71 0.4
72 0.36
73 0.34
74 0.36
75 0.35
76 0.3
77 0.26
78 0.19
79 0.17
80 0.21
81 0.2
82 0.19
83 0.21
84 0.22
85 0.2
86 0.2
87 0.21
88 0.2
89 0.21
90 0.26
91 0.27
92 0.27
93 0.32
94 0.32
95 0.33
96 0.31
97 0.32
98 0.29
99 0.31
100 0.31
101 0.27
102 0.27
103 0.25
104 0.27
105 0.31
106 0.31
107 0.33
108 0.4
109 0.49
110 0.56
111 0.63
112 0.7
113 0.73