Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VF08

Protein Details
Accession A0A397VF08    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
133-159DPTGSKKDKKIKPFVPQKYNKIRKLHLHydrophilic
NLS Segment(s)
PositionSequence
138-144KKDKKIK
Subcellular Location(s) extr 8, E.R. 6, mito 3, nucl 2, plas 2, golg 2, vacu 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MKFSIIIITLTFLFVVVSARFGQEHKNNAIEKLHMSVGHTEKDGFINAALGDLSGVMVDSLLAAAPACAMQDQCDNLIDIAYYLGGSKKTKLIKLAKSILRSEKNTPLRGQRSVLCCKKPRHKELDGLFPKQDPTGSKKDKKIKPFVPQKYNKIRKLHLTLDHKVIFPNLKRFPLRGNKTNCTYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.07
4 0.09
5 0.09
6 0.1
7 0.11
8 0.12
9 0.2
10 0.24
11 0.29
12 0.31
13 0.36
14 0.37
15 0.39
16 0.4
17 0.33
18 0.29
19 0.26
20 0.24
21 0.19
22 0.19
23 0.23
24 0.24
25 0.24
26 0.23
27 0.2
28 0.19
29 0.2
30 0.19
31 0.13
32 0.1
33 0.09
34 0.08
35 0.08
36 0.07
37 0.06
38 0.05
39 0.04
40 0.04
41 0.03
42 0.03
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.03
54 0.03
55 0.03
56 0.03
57 0.05
58 0.07
59 0.07
60 0.08
61 0.08
62 0.09
63 0.08
64 0.08
65 0.07
66 0.05
67 0.05
68 0.04
69 0.03
70 0.03
71 0.04
72 0.06
73 0.07
74 0.08
75 0.13
76 0.15
77 0.17
78 0.24
79 0.3
80 0.33
81 0.39
82 0.46
83 0.44
84 0.45
85 0.46
86 0.46
87 0.44
88 0.42
89 0.4
90 0.42
91 0.44
92 0.44
93 0.44
94 0.45
95 0.44
96 0.44
97 0.42
98 0.37
99 0.38
100 0.44
101 0.48
102 0.47
103 0.5
104 0.56
105 0.64
106 0.69
107 0.71
108 0.7
109 0.68
110 0.69
111 0.66
112 0.7
113 0.65
114 0.58
115 0.51
116 0.43
117 0.4
118 0.31
119 0.29
120 0.21
121 0.22
122 0.29
123 0.38
124 0.44
125 0.52
126 0.62
127 0.67
128 0.74
129 0.77
130 0.75
131 0.76
132 0.8
133 0.81
134 0.81
135 0.83
136 0.84
137 0.85
138 0.87
139 0.84
140 0.81
141 0.76
142 0.74
143 0.73
144 0.7
145 0.68
146 0.66
147 0.63
148 0.64
149 0.61
150 0.52
151 0.46
152 0.42
153 0.4
154 0.38
155 0.43
156 0.4
157 0.45
158 0.48
159 0.49
160 0.55
161 0.58
162 0.62
163 0.61
164 0.65
165 0.65