Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397W424

Protein Details
Accession A0A397W424    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
75-94LSFLCKLKFTKKYRKIIFILHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, mito 10, E.R. 5, cyto_mito 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIKAWILFFFYHPWIYVYTKLKAKNPVNQIIIILFPLIHMFKIFTTEKIHLGKVFSVIYPSAIFLIQCILFLGQLSFLCKLKFTKKYRKIIFIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.26
4 0.27
5 0.3
6 0.34
7 0.38
8 0.42
9 0.49
10 0.52
11 0.53
12 0.55
13 0.57
14 0.54
15 0.5
16 0.45
17 0.36
18 0.31
19 0.23
20 0.15
21 0.07
22 0.05
23 0.06
24 0.06
25 0.05
26 0.05
27 0.05
28 0.05
29 0.1
30 0.11
31 0.11
32 0.14
33 0.16
34 0.19
35 0.2
36 0.21
37 0.17
38 0.18
39 0.16
40 0.15
41 0.14
42 0.1
43 0.1
44 0.1
45 0.1
46 0.09
47 0.09
48 0.08
49 0.07
50 0.07
51 0.06
52 0.08
53 0.07
54 0.07
55 0.07
56 0.07
57 0.06
58 0.07
59 0.07
60 0.06
61 0.07
62 0.09
63 0.11
64 0.12
65 0.13
66 0.15
67 0.19
68 0.27
69 0.36
70 0.44
71 0.53
72 0.62
73 0.72
74 0.78