Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397W1S4

Protein Details
Accession A0A397W1S4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
80-102KEGSQPIRQKRNQRRRNFERLLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032394  Anoct_dimer  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF16178  Anoct_dimer  
Amino Acid Sequences MSEPSQASTSEEVHKISVPEEAIEVIEEGMKEWVKDHPNEGLFECIEEFGIRRLGDALAKVLYNYPFPDFIITYSDSDLKEGSQPIRQKRNQRRRNFERLLLKTGLIIEQEQDAASENVYIKLYAPFEKLCEQAEVIKLRMRLDTTNMKELKELEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.2
4 0.2
5 0.16
6 0.14
7 0.14
8 0.13
9 0.11
10 0.11
11 0.1
12 0.07
13 0.07
14 0.07
15 0.07
16 0.09
17 0.09
18 0.09
19 0.09
20 0.15
21 0.19
22 0.2
23 0.22
24 0.25
25 0.27
26 0.29
27 0.29
28 0.25
29 0.21
30 0.2
31 0.18
32 0.12
33 0.1
34 0.09
35 0.08
36 0.07
37 0.1
38 0.1
39 0.09
40 0.1
41 0.11
42 0.11
43 0.11
44 0.11
45 0.08
46 0.09
47 0.08
48 0.1
49 0.1
50 0.1
51 0.11
52 0.11
53 0.1
54 0.1
55 0.12
56 0.1
57 0.1
58 0.12
59 0.12
60 0.11
61 0.12
62 0.14
63 0.12
64 0.12
65 0.12
66 0.09
67 0.09
68 0.1
69 0.11
70 0.14
71 0.19
72 0.26
73 0.35
74 0.4
75 0.49
76 0.59
77 0.69
78 0.74
79 0.78
80 0.82
81 0.82
82 0.87
83 0.81
84 0.77
85 0.76
86 0.71
87 0.66
88 0.56
89 0.48
90 0.38
91 0.33
92 0.27
93 0.17
94 0.14
95 0.09
96 0.08
97 0.08
98 0.07
99 0.07
100 0.08
101 0.07
102 0.07
103 0.08
104 0.08
105 0.1
106 0.1
107 0.1
108 0.09
109 0.12
110 0.14
111 0.14
112 0.17
113 0.16
114 0.19
115 0.22
116 0.22
117 0.21
118 0.21
119 0.2
120 0.21
121 0.26
122 0.26
123 0.25
124 0.27
125 0.27
126 0.27
127 0.29
128 0.28
129 0.24
130 0.28
131 0.37
132 0.38
133 0.46
134 0.46
135 0.43
136 0.43