FuNGI

A0A397TVW9

Protein Details

Accession

A0A397TVW9

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
155-175	VCNGHHRKHRWPKYKGMDEFK	Basic

NLS Segment(s)

Subcellular Location(s)

plas 12, mito 4, E.R. 4, pero 2, vacu 2, cyto_mito 2

Family & Domain DBs

InterPro	View protein in InterPro IPR036188 FAD/NAD-bd_sf IPR000960 Flavin_mOase IPR020946 Flavin_mOase-like IPR002257 Flavin_mOase_5
Gene Ontology	GO:0005789 C:endoplasmic reticulum membrane GO:0050660 F:flavin adenine dinucleotide binding GO:0047822 F:hypotaurine dehydrogenase activity GO:0004499 F:N,N-dimethylaniline monooxygenase activity GO:0016174 F:NAD(P)H oxidase H2O2-forming activity GO:0050661 F:NADP binding GO:0006629 P:lipid metabolic process
Pfam	View protein in Pfam PF00743 FMO-like

Amino Acid Sequences

MVKPRVAIIGAGSSGLAALKQCLDDDLVPICFEQTSYVGGLWNFVEIDDKNKDPHSSAYKSLVINTSKELMTFSDFPIPAEWPHYLHNSLVTKYFNMYADNFKLRQYIKFHTTVVRVSYLPDHRWKVKYITCVDKDQTGEKQNSEHEEIFDFVMVCNGHHRKHRWPKYKGMDEFKGEQTHSHFYRRSASFENKRVVVVGVGNSGVDIAVELSHVASQVYLCVRRGTLPWIFPRLIGGKPIDHLRSRFSTYFLPRSPSAYAKLIVKTLGPHPPSFQPTTTSIFSSHPTLKSELFERLSTGTIIVTKNILELMPDETKSIKFVDGSTVENINVIIYATGYNIDFPFLDRDIINGGSEIEQEFEDEYKENLAWMYKMMFPPNYRNIAFIGLVQPIGAIFPIIEMQTRYVTSLIKGFINPLPSPQDMNIAIRDYHNKLRKRYYLSARHTIQVDYHSYLDELSLELGCYPYPLEILKKFGFDIWKLSMFGLRTPIQYRLLGRQCWEGAKDAIMIYNKVNPN

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.1
2	0.1
3	0.08
4	0.05
5	0.07
6	0.08
7	0.09
8	0.09
9	0.1
10	0.13
11	0.13
12	0.15
13	0.17
14	0.16
15	0.16
16	0.16
17	0.15
18	0.13
19	0.12
20	0.12
21	0.1
22	0.11
23	0.12
24	0.12
25	0.14
26	0.14
27	0.15
28	0.13
29	0.13
30	0.11
31	0.1
32	0.13
33	0.11
34	0.17
35	0.2
36	0.21
37	0.23
38	0.26
39	0.28
40	0.26
41	0.34
42	0.36
43	0.36
44	0.38
45	0.41
46	0.43
47	0.42
48	0.44
49	0.43
50	0.37
51	0.34
52	0.33
53	0.31
54	0.26
55	0.25
56	0.23
57	0.18
58	0.21
59	0.21
60	0.2
61	0.25
62	0.25
63	0.25
64	0.26
65	0.26
66	0.21
67	0.23
68	0.22
69	0.16
70	0.19
71	0.22
72	0.22
73	0.21
74	0.27
75	0.27
76	0.27
77	0.28
78	0.27
79	0.24
80	0.24
81	0.27
82	0.21
83	0.2
84	0.21
85	0.24
86	0.28
87	0.32
88	0.31
89	0.29
90	0.33
91	0.32
92	0.36
93	0.36
94	0.37
95	0.38
96	0.4
97	0.41
98	0.41
99	0.42
100	0.39
101	0.35
102	0.31
103	0.26
104	0.24
105	0.3
106	0.29
107	0.31
108	0.36
109	0.39
110	0.42
111	0.45
112	0.46
113	0.46
114	0.46
115	0.49
116	0.48
117	0.52
118	0.5
119	0.53
120	0.51
121	0.48
122	0.45
123	0.41
124	0.41
125	0.37
126	0.36
127	0.32
128	0.33
129	0.32
130	0.35
131	0.36
132	0.3
133	0.25
134	0.24
135	0.24
136	0.21
137	0.19
138	0.14
139	0.09
140	0.11
141	0.1
142	0.09
143	0.16
144	0.19
145	0.22
146	0.28
147	0.32
148	0.41
149	0.52
150	0.63
151	0.65
152	0.68
153	0.75
154	0.79
155	0.84
156	0.81
157	0.77
158	0.72
159	0.65
160	0.64
161	0.57
162	0.49
163	0.4
164	0.34
165	0.3
166	0.32
167	0.3
168	0.31
169	0.29
170	0.28
171	0.37
172	0.36
173	0.37
174	0.36
175	0.44
176	0.46
177	0.51
178	0.53
179	0.45
180	0.43
181	0.39
182	0.34
183	0.25
184	0.18
185	0.12
186	0.09
187	0.08
188	0.08
189	0.07
190	0.07
191	0.05
192	0.04
193	0.03
194	0.02
195	0.02
196	0.03
197	0.03
198	0.03
199	0.03
200	0.04
201	0.04
202	0.03
203	0.03
204	0.05
205	0.07
206	0.08
207	0.09
208	0.1
209	0.1
210	0.11
211	0.12
212	0.15
213	0.16
214	0.19
215	0.21
216	0.25
217	0.25
218	0.23
219	0.25
220	0.23
221	0.2
222	0.19
223	0.17
224	0.13
225	0.15
226	0.18
227	0.18
228	0.18
229	0.19
230	0.19
231	0.21
232	0.25
233	0.24
234	0.23
235	0.26
236	0.28
237	0.33
238	0.31
239	0.32
240	0.28
241	0.3
242	0.3
243	0.26
244	0.25
245	0.2
246	0.2
247	0.19
248	0.2
249	0.17
250	0.16
251	0.14
252	0.13
253	0.14
254	0.19
255	0.19
256	0.18
257	0.2
258	0.23
259	0.26
260	0.26
261	0.24
262	0.2
263	0.22
264	0.26
265	0.24
266	0.22
267	0.2
268	0.19
269	0.2
270	0.21
271	0.21
272	0.19
273	0.2
274	0.21
275	0.2
276	0.2
277	0.21
278	0.21
279	0.2
280	0.18
281	0.17
282	0.16
283	0.16
284	0.15
285	0.13
286	0.09
287	0.1
288	0.1
289	0.09
290	0.09
291	0.08
292	0.08
293	0.08
294	0.07
295	0.05
296	0.06
297	0.09
298	0.11
299	0.11
300	0.11
301	0.12
302	0.13
303	0.14
304	0.14
305	0.1
306	0.09
307	0.09
308	0.14
309	0.14
310	0.16
311	0.17
312	0.17
313	0.16
314	0.15
315	0.15
316	0.1
317	0.08
318	0.06
319	0.04
320	0.04
321	0.04
322	0.04
323	0.05
324	0.05
325	0.06
326	0.06
327	0.07
328	0.06
329	0.07
330	0.1
331	0.1
332	0.11
333	0.1
334	0.11
335	0.12
336	0.13
337	0.12
338	0.09
339	0.09
340	0.08
341	0.09
342	0.08
343	0.07
344	0.06
345	0.07
346	0.07
347	0.07
348	0.08
349	0.08
350	0.08
351	0.08
352	0.08
353	0.08
354	0.08
355	0.09
356	0.08
357	0.08
358	0.1
359	0.12
360	0.14
361	0.17
362	0.2
363	0.22
364	0.29
365	0.34
366	0.38
367	0.35
368	0.34
369	0.32
370	0.31
371	0.29
372	0.23
373	0.19
374	0.13
375	0.13
376	0.12
377	0.1
378	0.08
379	0.07
380	0.06
381	0.04
382	0.03
383	0.03
384	0.05
385	0.05
386	0.06
387	0.07
388	0.09
389	0.11
390	0.11
391	0.12
392	0.12
393	0.13
394	0.13
395	0.16
396	0.16
397	0.15
398	0.15
399	0.17
400	0.18
401	0.22
402	0.21
403	0.21
404	0.24
405	0.24
406	0.26
407	0.23
408	0.27
409	0.23
410	0.26
411	0.25
412	0.22
413	0.22
414	0.22
415	0.27
416	0.27
417	0.34
418	0.4
419	0.45
420	0.49
421	0.58
422	0.63
423	0.67
424	0.72
425	0.73
426	0.75
427	0.77
428	0.79
429	0.72
430	0.69
431	0.62
432	0.53
433	0.45
434	0.39
435	0.35
436	0.28
437	0.26
438	0.23
439	0.21
440	0.2
441	0.18
442	0.14
443	0.1
444	0.08
445	0.08
446	0.07
447	0.07
448	0.08
449	0.07
450	0.07
451	0.07
452	0.06
453	0.08
454	0.09
455	0.15
456	0.17
457	0.24
458	0.25
459	0.26
460	0.26
461	0.29
462	0.32
463	0.28
464	0.31
465	0.29
466	0.31
467	0.3
468	0.3
469	0.31
470	0.26
471	0.27
472	0.28
473	0.25
474	0.26
475	0.28
476	0.32
477	0.32
478	0.35
479	0.36
480	0.4
481	0.46
482	0.44
483	0.44
484	0.47
485	0.46
486	0.46
487	0.44
488	0.38
489	0.32
490	0.31
491	0.3
492	0.23
493	0.25
494	0.24
495	0.23
496	0.21

A0A397TVW9

3D AlphaFold-predicted Structure Viewer