Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397W0T7

Protein Details
Accession A0A397W0T7    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
154-180SATDLKDKARNEKKKRTREGRLIGVFHHydrophilic
NLS Segment(s)
PositionSequence
161-172KARNEKKKRTRE
Subcellular Location(s) nucl 19, cyto 4, mito 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MELLEEQGICGYGDTDAMSDTLTIRSDGLANSFNEEQNERTEGSQTASLTKDSINEMDLRNKVTDWLINVAEPTSQNDEVRDITRPPILPNEDSPTRLPQEMASRLRQRFKRRKWMDSELTALEKGMKKYTDDKLIWVHILKDETYGPTLKNRSATDLKDKARNEKKKRTREGRLIGVFHLASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.06
6 0.06
7 0.07
8 0.08
9 0.09
10 0.09
11 0.08
12 0.09
13 0.1
14 0.1
15 0.12
16 0.14
17 0.14
18 0.18
19 0.19
20 0.2
21 0.2
22 0.22
23 0.2
24 0.19
25 0.21
26 0.18
27 0.17
28 0.18
29 0.17
30 0.17
31 0.19
32 0.16
33 0.17
34 0.17
35 0.17
36 0.15
37 0.15
38 0.14
39 0.13
40 0.13
41 0.11
42 0.13
43 0.14
44 0.19
45 0.2
46 0.2
47 0.19
48 0.19
49 0.19
50 0.17
51 0.17
52 0.13
53 0.15
54 0.13
55 0.13
56 0.13
57 0.12
58 0.12
59 0.11
60 0.11
61 0.13
62 0.13
63 0.13
64 0.14
65 0.15
66 0.16
67 0.16
68 0.16
69 0.12
70 0.12
71 0.15
72 0.15
73 0.14
74 0.18
75 0.19
76 0.19
77 0.19
78 0.23
79 0.22
80 0.23
81 0.24
82 0.22
83 0.21
84 0.2
85 0.18
86 0.15
87 0.2
88 0.24
89 0.26
90 0.3
91 0.35
92 0.39
93 0.46
94 0.5
95 0.56
96 0.6
97 0.65
98 0.7
99 0.7
100 0.75
101 0.76
102 0.78
103 0.73
104 0.66
105 0.6
106 0.51
107 0.45
108 0.38
109 0.29
110 0.24
111 0.21
112 0.2
113 0.19
114 0.18
115 0.19
116 0.25
117 0.3
118 0.34
119 0.32
120 0.33
121 0.33
122 0.35
123 0.34
124 0.29
125 0.26
126 0.2
127 0.21
128 0.18
129 0.16
130 0.16
131 0.15
132 0.17
133 0.17
134 0.15
135 0.21
136 0.24
137 0.24
138 0.29
139 0.28
140 0.33
141 0.38
142 0.41
143 0.44
144 0.5
145 0.52
146 0.54
147 0.56
148 0.59
149 0.64
150 0.71
151 0.71
152 0.74
153 0.8
154 0.83
155 0.91
156 0.91
157 0.91
158 0.91
159 0.9
160 0.89
161 0.85
162 0.76
163 0.66
164 0.61