Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UEV8

Protein Details
Accession A0A397UEV8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-67RETAREEKRQEKKNGKRNGKKNDSKRNDGKRNDNKRNYSKRNGSKRNGGKRNGGKRNGBasic
NLS Segment(s)
PositionSequence
15-69EEKRQEKKNGKRNGKKNDSKRNDGKRNDNKRNYSKRNGSKRNGGKRNGGKRNGGK
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MTPSETLTARETAREEKRQEKKNGKRNGKKNDSKRNDGKRNDNKRNYSKRNGSKRNGGKRNGGKRNGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.49
4 0.58
5 0.65
6 0.72
7 0.75
8 0.77
9 0.79
10 0.85
11 0.85
12 0.86
13 0.86
14 0.87
15 0.87
16 0.86
17 0.87
18 0.88
19 0.83
20 0.82
21 0.81
22 0.81
23 0.8
24 0.76
25 0.77
26 0.76
27 0.81
28 0.83
29 0.82
30 0.8
31 0.82
32 0.87
33 0.84
34 0.83
35 0.82
36 0.82
37 0.84
38 0.85
39 0.81
40 0.81
41 0.84
42 0.85
43 0.83
44 0.78
45 0.77
46 0.78
47 0.83
48 0.82
49 0.78