Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TXD9

Protein Details
Accession A0A397TXD9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-75QDPNSRTYHRKERKEMIKNNNFDRSRHydrophilic
NLS Segment(s)
PositionSequence
75-77RKK
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences KIESSAPAGTILKGINFLKNGNDPVAKLEEEYPHWLWELLDEEKQKTQSQDPNSRTYHRKERKEMIKNNNFDRSRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.18
5 0.19
6 0.22
7 0.23
8 0.22
9 0.22
10 0.19
11 0.2
12 0.22
13 0.19
14 0.16
15 0.17
16 0.15
17 0.17
18 0.22
19 0.2
20 0.17
21 0.17
22 0.17
23 0.14
24 0.13
25 0.14
26 0.1
27 0.13
28 0.13
29 0.15
30 0.16
31 0.19
32 0.19
33 0.18
34 0.23
35 0.26
36 0.34
37 0.42
38 0.44
39 0.49
40 0.51
41 0.54
42 0.54
43 0.55
44 0.58
45 0.58
46 0.64
47 0.65
48 0.72
49 0.77
50 0.82
51 0.84
52 0.84
53 0.84
54 0.82
55 0.81
56 0.81
57 0.73